TBLASTN 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: gt_genome.fasta 1 sequences; 729,146 total letters Query= RESA_BACSU P35160 Thiol-disulfide oxidoreductase ResA Length=179 Score E Sequences producing significant alignments: (Bits) Value CP000557 CP000557.1 Geobacillus thermodenitrificans NG80-2, com... 48.1 9e-08 > CP000557 CP000557.1 Geobacillus thermodenitrificans NG80-2, complete genome. Length=729146 Score = 48.1 bits (113), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 32/104 (31%), Positives = 51/104 (50%), Gaps = 4/104 (3%) Frame = +3 Query 36 ISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEP-CKKEFPYMANQYKHFKSQ 94 I+ G AP+F L +NGK + LSD +G+ V L F+ P C E ++Y+ F Sbjct 544245 IAIGQPAPDFTLPASNGKMVSLSDFRGQYVVLYFYPKDMTPGCTTEACDFRDRYEQFT-- 544418 Query 95 GVEIVAVNVGESKIAVH-NFMKSYGVNFPVVLDTDRQVLDAYDV 137 G+ V + V + H F++ Y + F ++ D V + Y V Sbjct 544419 GLNAVILGVSTDPVKRHETFIEKYQLPFLLLSDEQHHVAELYGV 544550 Lambda K H 0.320 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26970780 Database: gt_genome.fasta Posted date: Oct 30, 2012 7:44 PM Number of letters in database: 729,146 Number of sequences in database: 1 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40