Short description of mercuric reductase from Halocynthiibacter arcticus bacterium genome
Last update on the 16th of October, 2016Bacteria resistance to heavy metal cations is governed by specialized systems. According to mercury there is a special complex including mercury(II) reductase, commonly known as MerA. It catalyzes the reduction[1] of Hg2+ to Hg0. The main properties of MerA genome organisation[2] in Halocynthiibacter arcticus are presented in table 1.
Attribute | Value |
---|---|
Protein ID | AML53752.1 |
Uniprot AC | A0A126V644 |
Genome fragment ID | CP014327.1 |
Gene location in genome | 3843873..3845306 |
Gene length, bp | 1434 |
Strand | Negative |
Protein length, aa | 477 |
The aminoacid sequence[2] of mercuric reductase is displayed in fig.1.
>AML53752.1 mercuric reductase [Halocynthiibacter arcticus] MPDLLNPNGVDTDTFDLAVIGAGSAGFSAAITAAEDGARVALIGYGTIGGTCVNVGCVPS KAMIRAVETLHSAKGAARFDGVEATARVTDWAAMVAQKQALVDDLRVAKYVDVLPNYESI TYIEGQASFAKDGSLHVGGRTICAPKVIIATGSSPHVPDILGLDGIDWLDSTSALEQEQL PKSLMVMGGGYIGVELAQIFARAGVAVTIVTRRGLLPEAEPEVSAALTKAFADEGIKVLD GLSYDRFEKSDETVILHAKHNGVAVEIKAEKLMLATGRVPNTGSLALDVAGIDTNARGGI VIDLQMRSTRDGVYATGDVTGTDQFVYMAAYGAKLAAKNAMNGNTLSYDNSVMPAVVFSD PQVASVGLTEAQAKTLGYEVVTSVLGLEHVPRALAARDTRGLIKLIAEKDSKKLLGAHII APEGADSIQTAAMALKMGMTYDDLGAMIFPYLTTVEGLKLAAQTFEKDVAKLSCCAG
Genomic neighbourhood
Proteins involved in one biochemical process are usually encoded closely in one genome fragment. The genomic neighbourhood of MerA made up in NCBI sequence viewer[3] is presented in fig. 2 and also in pdf.

Some properties of all proteins[4] presented in fig. 2 are listed in table 2.
Protein ID | Protein name | Location | Strand |
---|---|---|---|
AML53751.1 | acyl-CoA thioesterase | 3843102..3843446 | - |
AML53752.1 | Mercuric reductase | 3843873..3845306 | - |
AML53753.1 | Hypothetical protein (contains Transport_MerF region) | 3845326..3845508 | - |
AML53050.1 | Mercuric transport protein periplasmic component | 3845536..3845832 | - |
AML53051.1 | Mercury transporter MerT | 3845844..3846248 | - |
AML53052.1 | MerR family transcriptional regulator | 3846323..3846742 | + |
As it is seen, acyl-CoA tioestherase gene is placed further from MerA than other closely encoded proteins (500bp vs 20-30bp), so it is possible to say that 1) acyl-CoA tioestherase may not be related to mercury reduction and 2) gene sequences of related to reduction proteins may be transcribed into one RNA. Transcriptional regulator is encoded on the opposite DNA strand relatively closely to MerA that may have some sense in bacterium response regulation.
References
- Mercury(II) reductase article on Wikipedia;
- NCBI Reference Sequence: AML53752.1;
- NCBI sequence viewer: CP014327.1:3842941..3846909;
- NCBI Reference Sequence: CP014327.1.