| Название вида (русское) | Девятипоясный броненосец |
| Название вида (латинское) | Dasypus novemcinctus |
| Число сборок генома (использованная) | 2 (GCA_000208655.2) |
| Общая длина | 3,631,522,711 |
| Число контигов | 314,972 |
| Число скэффолдов сборки | 46,559 |
| Scaffold N50 | 1,687,935 |
| Scaffold L50 | 568 |
| Contig N50 | 26,277 |
| Contig L50 | 37,255 |
| Число аннотированных белков | 38,178 |
| Ссылка на публикацию с описанием проекта | |
| Ссылка на последовательность 33-го контига | |
Feature Key |
Definition |
Example |
| gene | region of biological interest identified as a gene and for which a name has been assigned | <1..1050
/gene="ATH1" |
| source | identifies the biological source of the specified span of the sequence; this key is mandatory; more than one source key per sequence is allowed; every entry/record will have, as a minimum, either a single source key spanning the entire sequence or multiple source keys, which together, span the entire sequence |
1..7000 /organism="Saccharomyces cerevisiae" /strain="S288C" /chromosome="XVI" |
| mRNA | messenger RNA; includes 5'untranslated region (5'UTR), coding sequences (CDS, exon) and 3'untranslated region (3'UTR) |
<1..1050 /gene="ATH1" /product="acid trehalase" |
| CDS | coding sequence; sequence of nucleotides that corresponds with the sequence of amino acids in a protein (location includes stop codon); feature includes amino acid conceptual translation |
<1..1009 /gene="ATH1" /note="Ath1p" /codon_start=2 /product="acid trehalase" /translation="DHNGTIVHKSGDVPIHIKIPNRSLIHDQDINFYNGSENERKPNL ERRDVDRVGDPMRMDRYGTYYLLKPKQELTVQLFKPGLNARNNIAENKQITNLTAGVP GDVAFSALDGNNYTHWQPLDKIHRAKLLIDLGEYNEKEITKGMILWGQRPAKNISISI LPHSEKVENLFANVTEIMQNSGNDQLLNETIGQLLDNAGIPVENVIDFDGIEQEDDES LDDVQALLHWKKEDLAKLIEQIPRLNFLKRKFVKILDNVPVSPSEPYYEASRNQSLIE ILPSNRTTFTIDYDKLQVGDKGNTDWRKTRYIVVAVQGVYDDYDDDNKGATIKEIVLN D" |
| exon | region of genome that codes for portion of spliced mRNA, rRNA and tRNA; may contain 5'UTR, all CDSs and 3' UTR |
complement(4535..4570) /number=1 |
| tRNA | mature transfer RNA, a small RNA molecule (75-85 bases long) that mediates the translation of a nucleic acid sequence into an amino acid sequence |
complement(join(4535..4570,4590..4626)) /product="tRNA-Phe" |
| assembly_gap | gap between two components of a genome or transcriptome assembly |
2939417..3289416 /estimated_length=350000 /gap_type="between scaffolds" |
| Название проекта | 100,000 Genomes Project |
| Цель | Упорядочивание геномов людей с записью их истории болезней, с целью быстрой диагностики заболеваний |
| Год начала работ | 2012 |
| Организация | Government of the United Kingdom |
| Страна | Великобритания |
| Планируемое число геномов | 100,000 |
| Планируемый год завершения | По завершении запланированных работ (неизвестно) |
| Количество секвенированных геномов на 2018 год | 87,231 |
| Страница проекта | |
| Последняя публикация | |
| Банк | ENA |
| Запрос | tax_tree(1913637) AND mol_type="genomic DNA" AND topology="CIRCULAR" AND organelle="mitochondrion" |
| Число находок в Release/Update | 27/0 |
| Название по латыни / по-русски | Rhizopus oryzae / Ризопус рисовый |
|
|
|
| AC | AY863212.1 |
| Таблица с генами белком | |
Учебные реалии, или список семестров;
© Daniel Igumnov, 2018