>ref|NP_416563.1| Gene info linked to NP_416563.1 predicted glycosyl transferase [Escherichia coli str. K-12 substr. MG1655] ref|AP_002659.1| predicted glycosyl transferase [Escherichia coli str. K-12 substr. W3110] ref|YP_001731009.1| Gene info linked to YP_001731009.1 glycosyl transferase [Escherichia coli str. K-12 substr. DH10B] 9 more sequence titles ref|YP_002927045.1| Gene info linked to YP_002927045.1 putative glycosyl transferase [Escherichia coli BW2952] sp|P77414.1|WCAA_ECOLI RecName: Full=Putative colanic acid biosynthesis glycosyl transferase wcaA gb|AAC77836.1| putative glycosyl transferase [Escherichia coli] dbj|BAA15912.1| predicted glycosyl transferase [Escherichia coli str. K12 substr. W3110] gb|AAC75120.1| Gene info linked to AAC75120.1 predicted glycosyl transferase [Escherichia coli str. K-12 substr. MG1655] gb|ACB03231.1| Gene info linked to ACB03231.1 predicted glycosyl transferase [Escherichia coli str. K-12 substr. DH10B] gb|ACR64445.1| Gene info linked to ACR64445.1 predicted glycosyl transferase [Escherichia coli BW2952] gb|ACX39263.1| glycosyl transferase family 2 [Escherichia coli DH1] dbj|BAJ43852.1| putative glycosyl transferase [Escherichia coli DH1] Length=279 Sort alignments for this subject sequence by: E value Score Percent identity Query start position Subject start position Score = 69.3 bits (168), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 14/121 (12%) Query 2 PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNE-ETLNVIRPFLNDNRVRF 60 P +S+ M ++N+ ++I S+L Q +S++E+ I+DD S E L LND R+ + Sbjct 5 PLISIYMPTWNRQQLAIRAIKSVLRQDYSNWEMIIVDDCSTSWEQLQQYVTALNDPRITY 64 Query 61 YQSDI-SGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRL---LKMVRELDT 116 +DI SG A+ NQAI +A+GEYIT DD+ + P+RL L ++L T Sbjct 65 IHNDINSGA---------CAVRNQAIMLAQGEYITGIDDDDEWTPNRLSVFLAHKQQLVT 115 Query 117 H 117 H Sbjct 116 H 116 Score = 15.8 bits (29), Expect = 1.0, Method: Compositional matrix adjust. Identities = 5/14 (36%), Positives = 7/14 (50%), Gaps = 0/14 (0%) Query 185 AFYRIGDARFFWRV 198 Y+I + R WR Sbjct 246 TLYQIRNKRMTWRT 259 Score = 13.5 bits (23), Expect = 4.9, Method: Compositional matrix adjust. Identities = 5/7 (71%), Positives = 5/7 (71%), Gaps = 0/7 (0%) Query 126 ASKTYHL 132 ASK Y L Sbjct 238 ASKKYQL 244