This is a result of script 'evolve_protein.pl', version 1.0 Output is created at: Sat May 25 13:40:13 2013 ----------- Script parameters ----------- Probability of residue change = 0.4 Probability of residue replacement = 0.8 < > Probability of insertion = 0.100 < > Probability of deletion = 0.100 Number of residues taken from resulting sequence = 20 Number of sequences to generate = 1 Number of generations for each sequence = 1 ----------------------------------------- Input FASTA data and resulting sequences as follows: >sp|P39594|THIE_BACSU Thiamine-phosphate synthase OS=Bacillus subtilis (strain 168) GN=thiE PE=1 SV=1 MTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR >0|simulation_result|change=0.4|replace=0.8|generations=1 ISQCEDPESAARKAREEIQT