RID: 14BHTVY0014 Job Title:POLG_DEN1W P17763 Genome polyprotein (Capsid... Program: BLASTP Query: POLG_DEN1W P17763 Genome polyprotein (Capsid protein C) (Capsid protein) (Core protein) (Protein prM) (Precursor membrane protein) (Peptide pr) (Peptide precursor) (Small envelope protein M) (Matrix protein) (Envelope protein E) (Non-structural protein 1) (NS1) (Non-structural protein 2A) (NS2A) (Serine protease subunit NS2B) (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B) (Serine protease NS3) (3.4.21.91) (3.6.1.15 {ECO:0000250|UniProtKB:Q9Q6P4}) (3.6.4.13 {ECO:0000250|UniProtKB:Q9Q6P4}) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3) (Non-structural protein 4A) (NS4A) (Peptide 2k) (Non-structural protein 4B) (NS4B) (RNA-directed RNA polymerase/Methyltransferase NS5) (2.1.1.56 {ECO:0000255|PROSITE-ProRule:PRU00924}) (2.1.1.57 {ECO:0000255|PROSITE-ProRule:PRU00924}) (2.7.7.48 {ECO:0000255|PROSITE-ProRule:PRU00539}) (Non-structural protein 5) ID: lcl|Query_1004327(amino acid) Length: 101 Database: swissprot Non-redundant UniProtKB/SwissProt sequences Sequences producing significant alignments: Scientific Common Max Total Query E Per. Acc. Description Name Name Taxid Score Score cover Value Ident Len Accession RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11059 209 209 100% 5e-63 100.00 3392 P17763.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 33741 204 204 100% 2e-61 98.02 3391 P33478.2 RecName: Full=Genome polyprotein; Contains: RecName:... Dengue virus... NA 408685 202 202 100% 1e-60 97.03 3392 P27909.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11058 200 200 100% 1e-60 97.03 791 P27913.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11057 196 196 100% 3e-59 93.07 792 P27912.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408691 187 187 100% 2e-55 86.14 3390 Q6YMS3.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408692 186 186 100% 3e-55 86.14 3390 Q6YMS4.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408690 186 186 100% 5e-55 85.15 3390 Q99D35.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408870 186 186 100% 5e-55 85.15 3390 P27915.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408693 186 186 100% 5e-55 85.15 3390 Q5UB51.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 413041 155 155 100% 2e-44 72.28 3391 P14337.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408694 154 154 100% 6e-44 71.29 3391 Q9WDA6.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11065 154 154 100% 6e-44 71.29 3391 P14340.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11064 154 154 100% 7e-44 71.29 3391 P07564.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 31634 154 154 100% 1e-43 71.29 3391 P29990.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 11066 152 152 100% 3e-43 70.30 3388 P12823.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 31635 152 152 100% 4e-43 70.30 3391 P29991.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408688 151 151 98% 9e-43 70.71 3387 Q2YHF0.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408686 149 149 98% 3e-42 70.71 3387 Q58HT7.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408687 149 149 98% 5e-42 70.71 3387 Q5UCB8.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408871 149 149 98% 7e-42 70.71 3387 P09866.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 408689 146 146 98% 3e-41 69.70 3387 Q2YHF2.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Dengue virus... NA 31636 142 142 100% 1e-39 65.35 1127 P30026.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Zika virus Z... NA 2316109 93.2 93.2 98% 2e-22 48.00 3423 A0A142I5B9.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Zika virus Z... NA 2043570 93.2 93.2 98% 2e-22 48.00 3423 A0A024B7W1.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Zika virus NA 64320 89.0 89.0 98% 7e-21 45.00 3419 Q32ZE1.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Kokobera virus NA 44024 85.9 85.9 94% 7e-20 43.43 3410 Q32ZD5.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Bussuquara v... NA 64304 84.0 84.0 93% 4e-19 39.80 3429 Q32ZE0.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Tembusu virus NA 64293 79.0 79.0 93% 2e-17 41.84 3425 G1CRV4.1 RecName: Full=Genome polyprotein; Contains: RecName:... Usutu virus NA 64286 78.2 78.2 92% 4e-17 42.27 3434 Q5WPU5.1 RecName: Full=Genome polyprotein; Contains: RecName:... Kunjin virus... NA 11078 78.2 78.2 92% 4e-17 44.33 3433 P14335.1 RecName: Full=Structural polyprotein; Contains: RecName:... Japanese enc... NA 11073 76.3 76.3 94% 2e-16 39.39 1198 P0DOH7.1 RecName: Full=Structural polyprotein; Contains: RecName:... Japanese enc... NA 11074 76.3 76.3 94% 2e-16 39.39 1198 P0DOH9.1 RecName: Full=Structural polyprotein; Contains: RecName:... Japanese enc... NA 11075 76.3 76.3 94% 2e-16 39.39 1198 P0DOH8.1 RecName: Full=Genome polyprotein; Contains: RecName:... West Nile vi... NA 1968826 75.9 75.9 92% 2e-16 43.30 3433 Q9Q6P4.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Japanese enc... NA 11073 75.1 75.1 94% 5e-16 39.39 3432 P27395.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Japanese enc... NA 11074 75.1 75.1 94% 5e-16 39.39 3432 P19110.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Japanese enc... NA 11075 75.1 75.1 94% 5e-16 39.39 3432 P32886.1 RecName: Full=Structural polyprotein; Contains: RecName:... Japanese enc... NA 2555554 74.3 74.3 94% 8e-16 38.38 1198 P0DOK8.1 RecName: Full=Genome polyprotein; Contains: RecName:... Murray valle... NA 301478 73.6 73.6 90% 2e-15 41.05 3434 P05769.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Japanese enc... NA 2555554 73.2 73.2 94% 2e-15 38.38 3432 G3FEX6.1 RecName: Full=Genome polyprotein; Contains: RecName:... West Nile virus NA 11082 73.2 73.2 92% 2e-15 42.27 3430 P06935.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Rocio virus NA 64315 70.5 70.5 90% 2e-14 54.95 3425 Q32ZD4.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Caps... Ilheus virus NA 59563 69.7 69.7 93% 4e-14 39.36 3424 Q32ZD7.1 Alignments: >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Capsid protein; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; AltName: Full=Precursor membrane protein; Contains: RecName: Full=Peptide pr; AltName: Full=Peptide precursor; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 1 Nauru/West Pac/1974] Sequence ID: P17763.2 Length: 3392 Range 1: 1 to 101 Score:209 bits(531), Expect:5e-63, Method:Composition-based stats., Identities:101/101(100%), Positives:101/101(100%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS Sbjct 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 1 Singapore/S275/1990] Sequence ID: P33478.2 Length: 3391 Range 1: 1 to 101 Score:204 bits(519), Expect:2e-61, Method:Composition-based stats., Identities:99/101(98%), Positives:99/101(98%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKT RPSFNMLKRARNRVST SQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTARPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS Sbjct 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Non-structural protein 2A-alpha; Short=NS2A-alpha; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 1 Brazil/97-11/1997] Sequence ID: P27909.2 Length: 3392 Range 1: 1 to 101 Score:202 bits(513), Expect:1e-60, Method:Composition-based stats., Identities:98/101(97%), Positives:99/101(98%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTGRPSFNMLKRARNRVST SQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGRPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGILARW SFKKNGAIKVLRGFKKEIS+MLNIMNRRKRS Sbjct 61 PTAGILARWSSFKKNGAIKVLRGFKKEISSMLNIMNRRKRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1 [Dengue virus 1 Jamaica/CV1636/1977] Sequence ID: P27913.1 Length: 791 Range 1: 1 to 101 Score:200 bits(508), Expect:1e-60, Method:Composition-based stats., Identities:98/101(97%), Positives:99/101(98%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTGRPSFNMLKRARNRVST SQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGRPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGILARW SFKKNGAIKVLRGFKKEIS+MLNIMNRRKRS Sbjct 61 PTAGILARWSSFKKNGAIKVLRGFKKEISSMLNIMNRRKRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1 [Dengue virus 1 Thailand/AHF 82-80/1980] Sequence ID: P27912.1 Length: 792 Range 1: 1 to 101 Score:196 bits(499), Expect:3e-59, Method:Composition-based stats., Identities:94/101(93%), Positives:97/101(96%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG PSFNMLKRARNRVST SQLAKRFSKGLLSGQGPMKLVMAF+AFLRFLAIP Sbjct 1 MNNQRKKTGNPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFVAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWGSFKKNGAI VLRGF+KEISNMLNIMNRR+RS Sbjct 61 PTAGILKRWGSFKKNGAINVLRGFRKEISNMLNIMNRRRRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 3 Martinique/1243/1999] Sequence ID: Q6YMS3.1 Length: 3390 Range 1: 1 to 101 Score:187 bits(474), Expect:2e-55, Method:Composition-based stats., Identities:87/101(86%), Positives:98/101(97%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG+PS NMLKR RNRVST SQLAKRFSKGLL+GQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSKGLLNGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAG+LARWG+FKK+GAIKVL+GFKKEISNML+I+N+RK++ Sbjct 61 PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINKRKKT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 3 Sri Lanka/1266/2000] Sequence ID: Q6YMS4.1 Length: 3390 Range 1: 1 to 101 Score:186 bits(473), Expect:3e-55, Method:Composition-based stats., Identities:87/101(86%), Positives:98/101(97%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG+PS NMLKR RNRVST SQLAKRFSKGLL+GQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSKGLLNGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAG+LARWG+FKK+GAIKVL+GFKKEISNML+I+N+RK++ Sbjct 61 PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINQRKKT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 3 China/80-2/1980] Sequence ID: Q99D35.1 Length: 3390 Range 1: 1 to 101 Score:186 bits(472), Expect:5e-55, Method:Composition-based stats., Identities:86/101(85%), Positives:98/101(97%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG+PS NMLKR RNRVST SQLAKRFS+GLL+GQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSRGLLNGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAG+LARWG+FKK+GAIKVL+GFKKEISNML+I+N+RK++ Sbjct 61 PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINKRKKT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 3 Philippines/H87/1956] Sequence ID: P27915.1 Length: 3390 Range 1: 1 to 101 Score:186 bits(472), Expect:5e-55, Method:Composition-based stats., Identities:86/101(85%), Positives:98/101(97%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG+PS NMLKR RNRVST SQLAKRFS+GLL+GQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSRGLLNGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAG+LARWG+FKK+GAIKVL+GFKKEISNML+I+N+RK++ Sbjct 61 PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINKRKKT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 3 Singapore/8120/1995] Sequence ID: Q5UB51.1 Length: 3390 Range 1: 1 to 101 Score:186 bits(472), Expect:5e-55, Method:Composition-based stats., Identities:86/101(85%), Positives:98/101(97%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKKTG+PS NMLKR RNRVST SQLAKRFS+GLL+GQGPMKLVMAFIAFLRFLAIP Sbjct 1 MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSRGLLNGQGPMKLVMAFIAFLRFLAIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAG+LARWG+FKK+GAIKVL+GFKKEISNML+I+N+RK++ Sbjct 61 PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINKRKKT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Thailand/0168/1979] Sequence ID: P14337.2 Length: 3391 Range 1: 1 to 101 Score:155 bits(393), Expect:2e-44, Method:Composition-based stats., Identities:73/101(72%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNNQRKKAKNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+RS Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Peru/IQT2913/1996] Sequence ID: Q9WDA6.1 Length: 3391 Range 1: 1 to 101 Score:154 bits(389), Expect:6e-44, Method:Composition-based stats., Identities:72/101(71%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNNQRKKARNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+R+ Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Thailand/NGS-C/1944] Sequence ID: P14340.2 Length: 3391 Range 1: 1 to 101 Score:154 bits(389), Expect:6e-44, Method:Composition-based stats., Identities:72/101(71%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNNQRKKARNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+R+ Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Jamaica/1409/1983] Sequence ID: P07564.2 Length: 3391 Range 1: 1 to 101 Score:154 bits(389), Expect:7e-44, Method:Composition-based stats., Identities:72/101(71%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNNQRKKARSTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+R+ Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Thailand/16681/84] Sequence ID: P29990.1 Length: 3391 Range 1: 1 to 101 Score:154 bits(388), Expect:1e-43, Method:Composition-based stats., Identities:72/101(71%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MN+QRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNDQRKKAKNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLYMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+RS Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 Puerto Rico/PR159-S1/1969] Sequence ID: P12823.1 Length: 3388 Range 1: 1 to 101 Score:152 bits(385), Expect:3e-43, Method:Composition-based stats., Identities:71/101(70%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MN+QRKK FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNDQRKKARNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+R+ Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 2 16681-PDK53] Sequence ID: P29991.1 Length: 3391 Range 1: 1 to 101 Score:152 bits(384), Expect:4e-43, Method:Composition-based stats., Identities:71/101(70%), Positives:82/101(81%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MN+QRK+ FNMLKR RNRVSTV QL KRFS G+L G+GP+KL MA +AFLRFL IP Sbjct 1 MNDQRKEAKNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLYMALVAFLRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI VLRGF+KEI MLNI+NRR+RS Sbjct 61 PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRS 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 4 Thailand/0348/1991] Sequence ID: Q2YHF0.1 Length: 3387 Range 1: 2 to 100 Score:151 bits(381), Expect:9e-43, Method:Composition-based stats., Identities:70/99(71%), Positives:79/99(79%), Gaps:0/99(0%) Query 3 NQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPT 62 NQRKK RP FNMLKR RNRVST L KRFS GL SG+GP+++V+AFI FLR L+IPPT Sbjct 2 NQRKKVARPPFNMLKRERNRVSTPQGLVKRFSTGLFSGKGPLRMVLAFITFLRVLSIPPT 61 Query 63 AGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 AGIL RWG KKN AIK+L GF+KEI MLNI+N RKRS Sbjct 62 AGILKRWGQLKKNKAIKILTGFRKEIGRMLNILNGRKRS 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 4 Philippines/H241/1956] Sequence ID: Q58HT7.1 Length: 3387 Range 1: 2 to 100 Score:149 bits(377), Expect:3e-42, Method:Composition-based stats., Identities:70/99(71%), Positives:79/99(79%), Gaps:0/99(0%) Query 3 NQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPT 62 NQRKK RP FNMLKR RNRVST L KRFS GL SG+GP+++V+AFI FLR L+IPPT Sbjct 2 NQRKKVVRPPFNMLKRERNRVSTPQGLVKRFSTGLFSGKGPLRMVLAFITFLRVLSIPPT 61 Query 63 AGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 AGIL RWG KKN AIK+L GF+KEI MLNI+N RKRS Sbjct 62 AGILKRWGQLKKNKAIKILTGFRKEIGRMLNILNGRKRS 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 4 Singapore/8976/1995] Sequence ID: Q5UCB8.1 Length: 3387 Range 1: 2 to 100 Score:149 bits(375), Expect:5e-42, Method:Composition-based stats., Identities:70/99(71%), Positives:79/99(79%), Gaps:0/99(0%) Query 3 NQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPT 62 NQRKK RP FNMLKR RNRVST L KRFS GL SG+GP+++V+AFI FLR L+IPPT Sbjct 2 NQRKKVVRPPFNMLKRERNRVSTPQGLVKRFSTGLFSGKGPLRMVLAFITFLRVLSIPPT 61 Query 63 AGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 AGIL RWG KKN AIK+L GF+KEI MLNI+N RKRS Sbjct 62 AGILKRWGQLKKNKAIKILIGFRKEIGRMLNILNGRKRS 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 4 Dominica/814669/1981] Sequence ID: P09866.2 Length: 3387 Range 1: 2 to 100 Score:149 bits(375), Expect:7e-42, Method:Composition-based stats., Identities:70/99(71%), Positives:79/99(79%), Gaps:0/99(0%) Query 3 NQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPT 62 NQRKK RP FNMLKR RNRVST L KRFS GL SG+GP+++V+AFI FLR L+IPPT Sbjct 2 NQRKKVVRPPFNMLKRERNRVSTPQGLVKRFSTGLFSGKGPLRMVLAFITFLRVLSIPPT 61 Query 63 AGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 AGIL RWG KKN AIK+L GF+KEI MLNI+N RKRS Sbjct 62 AGILKRWGQLKKNKAIKILIGFRKEIGRMLNILNGRKRS 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Dengue virus 4 Thailand/0476/1997] Sequence ID: Q2YHF2.1 Length: 3387 Range 1: 2 to 100 Score:146 bits(369), Expect:3e-41, Method:Composition-based stats., Identities:69/99(70%), Positives:78/99(78%), Gaps:0/99(0%) Query 3 NQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPT 62 NQRKK RP FNMLKR RNRVST L KRFS GL SG+GP+++V+AFI FLR L+IPPT Sbjct 2 NQRKKVVRPPFNMLKRERNRVSTPQGLVKRFSIGLFSGKGPLRMVLAFITFLRVLSIPPT 61 Query 63 AGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 AGIL RWG KK AIK+L GF+KEI MLNI+N RKRS Sbjct 62 AGILKRWGQLKKTKAIKILTGFRKEIGRMLNILNGRKRS 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1 [Dengue virus 2 China/D2-04] Sequence ID: P30026.1 Length: 1127 Range 1: 1 to 101 Score:142 bits(358), Expect:1e-39, Method:Composition-based stats., Identities:66/101(65%), Positives:78/101(77%), Gaps:0/101(0%) Query 1 MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIP 60 MNNQRKK FNML+R RNRVSTV QL KRFS G+L G+GP+KL MA +A RFL IP Sbjct 1 MNNQRKKARSTPFNMLRRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVALPRFLTIP 60 Query 61 PTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRS 101 PTAGIL RWG+ KK+ AI +RG +KEI MLNI+NRR+R+ Sbjct 61 PTAGILKRWGTIKKSKAINDVRGCRKEIGRMLNILNRRRRT 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Capsid protein; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; AltName: Full=Precursor membrane protein; Contains: RecName: Full=Peptide pr; AltName: Full=Peptide precursor; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Zika virus ZIKV/Human/Cambodia/FSS13025/2010] Sequence ID: A0A142I5B9.1 Length: 3423 Range 1: 1 to 99 Score:93.2 bits(230), Expect:2e-22, Method:Composition-based stats., Identities:48/100(48%), Positives:67/100(67%), Gaps:2/100(2%) Query 1 MNNQRKKTGRPSF-NMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAI 59 M N +KK+G NMLKR RVS L KR GLL G GP+++V+A +AFLRF AI Sbjct 1 MKNPKKKSGGFRIVNMLKRGVARVSPFGGL-KRLPAGLLLGHGPIRMVLAILAFLRFTAI 59 Query 60 PPTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 P+ G++ RWGS K A+++++ FKK+++ ML I+N RK Sbjct 60 KPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARK 99 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Capsid protein; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; AltName: Full=Precursor membrane protein; Contains: RecName: Full=Peptide pr; AltName: Full=Peptide precursor; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013] Sequence ID: A0A024B7W1.1 Length: 3423 Range 1: 1 to 99 Score:93.2 bits(230), Expect:2e-22, Method:Composition-based stats., Identities:48/100(48%), Positives:67/100(67%), Gaps:2/100(2%) Query 1 MNNQRKKTGRPSF-NMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAI 59 M N +KK+G NMLKR RVS L KR GLL G GP+++V+A +AFLRF AI Sbjct 1 MKNPKKKSGGFRIVNMLKRGVARVSPFGGL-KRLPAGLLLGHGPIRMVLAILAFLRFTAI 59 Query 60 PPTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 P+ G++ RWGS K A+++++ FKK+++ ML I+N RK Sbjct 60 KPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARK 99 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Capsid protein; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; AltName: Full=Precursor membrane protein; Contains: RecName: Full=Peptide pr; AltName: Full=Peptide precursor; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Zika virus] Sequence ID: Q32ZE1.1 Length: 3419 Range 1: 1 to 99 Score:89.0 bits(219), Expect:7e-21, Method:Composition-based stats., Identities:45/100(45%), Positives:67/100(67%), Gaps:2/100(2%) Query 1 MNNQRKKTGRPSF-NMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAI 59 M N +++ R NMLKR RV+ + L KR GLL G GP+++V+A +AFLRF AI Sbjct 1 MKNPKEEIRRIRIVNMLKRGVARVNPLGGL-KRLPAGLLLGHGPIRMVLAILAFLRFTAI 59 Query 60 PPTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 P+ G++ RWGS K A+++++ FKK+++ ML I+N RK Sbjct 60 KPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARK 99 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Kokobera virus] Sequence ID: Q32ZD5.1 Length: 3410 Range 1: 3 to 101 Score:85.9 bits(211), Expect:7e-20, Method:Composition-based stats., Identities:43/99(43%), Positives:64/99(64%), Gaps:4/99(4%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK GRP + NMLKR +R KR GLL G+GP+++V+A +AF RF A+ P Sbjct 3 KKPGRPGRNRAVNMLKRGASRALGPMIKLKRMLFGLLDGRGPLRMVLAILAFFRFTALKP 62 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 TAG+L RWG K A+ +L+GFKK++++M + ++ K+ Sbjct 63 TAGLLKRWGMMDKVHALSLLKGFKKDLASMTDFVHLPKK 101 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Bussuquara virus] Sequence ID: Q32ZE0.1 Length: 3429 Range 1: 3 to 100 Score:84.0 bits(206), Expect:4e-19, Method:Composition-based stats., Identities:39/98(40%), Positives:62/98(63%), Gaps:4/98(4%) Query 6 KKTGRPS----FNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 +K GRP NMLKR ++ LAKR +G+GP+++++A +AF RF AI Sbjct 3 RKPGRPGGNRVVNMLKRTAANAASPLGLAKRLLGDAFAGRGPLRVILAVVAFFRFTAIKM 62 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 + +L +WG+ +K AI +++ FKKEI +ML+++ RRK Sbjct 63 SPALLKKWGTVEKGAAIAIMKSFKKEIGSMLDVVARRK 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Tembusu virus] Sequence ID: G1CRV4.1 Length: 3425 Range 1: 4 to 100 Score:79.0 bits(193), Expect:2e-17, Method:Composition-based stats., Identities:41/98(42%), Positives:61/98(62%), Gaps:5/98(5%) Query 6 KKTGRPS----FNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK GRP NMLKR +R + ++++ KR G+L G GP++ V+A + F +F A+ P Sbjct 4 KKPGRPGSGRVVNMLKRGTSRGNPLARI-KRTIDGVLRGAGPIRFVLALLTFFKFTALRP 62 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 T G+L RW N A K L+ FK++I ML+ +N+RK Sbjct 63 TIGMLKRWKLVGVNEATKHLKSFKRDIGQMLDGLNKRK 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Usutu virus] Sequence ID: Q5WPU5.1 Length: 3434 Range 1: 3 to 98 Score:78.2 bits(191), Expect:4e-17, Method:Composition-based stats., Identities:41/97(42%), Positives:57/97(58%), Gaps:5/97(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR GLL G+GP++ V+A + F +F A+ P Sbjct 3 KKPGGPGRNRAINMLKRGIPRVFPLVGV-KRVVMGLLDGRGPVRFVLALMTFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRR 98 T +L RW K A+K L FKKE+ M+N++N R Sbjct 62 TKALLGRWKRINKTTAMKHLTSFKKELGTMINVVNNR 98 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease/Helicase NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [Kunjin virus (STRAIN MRM61C)] Sequence ID: P14335.1 Length: 3433 Range 1: 3 to 98 Score:78.2 bits(191), Expect:4e-17, Method:Composition-based stats., Identities:43/97(44%), Positives:58/97(59%), Gaps:5/97(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV +++ L KR L+ G+GP + V+A +AF RF AI P Sbjct 3 KKPGGPGKSRAVNMLKRGMPRVLSLTGL-KRAMLSLIDGRGPTRFVLALLAFFRFTAIAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRR 98 T +L RW S K A+K L FKKE+ + + +NRR Sbjct 62 TRAVLDRWRSVNKQTAMKHLLSFKKELGTLTSAINRR 98 >RecName: Full=Structural polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1'; Short=NS1' [Japanese encephalitis virus strain SA-14] Sequence ID: P0DOH7.1 Length: 1198 Range 1: 3 to 100 Score:76.3 bits(186), Expect:2e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Structural polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1'; Short=NS1' [Japanese encephalitis virus strain SA(V)] Sequence ID: P0DOH9.1 Length: 1198 Range 1: 3 to 100 Score:76.3 bits(186), Expect:2e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Structural polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1'; Short=NS1' [Japanese encephalitis virus strain JAOARS982] Sequence ID: P0DOH8.1 Length: 1198 Range 1: 3 to 100 Score:76.3 bits(186), Expect:2e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease/Helicase NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [West Nile virus strain NY-99] Sequence ID: Q9Q6P4.2 Length: 3433 Range 1: 3 to 98 Score:75.9 bits(185), Expect:2e-16, Method:Composition-based stats., Identities:42/97(43%), Positives:57/97(58%), Gaps:5/97(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV ++ L KR L+ G+GP++ V+A +AF RF AI P Sbjct 3 KKPGGPGKSRAVNMLKRGMPRVLSLIGL-KRAMLSLIDGKGPIRFVLALLAFFRFTAIAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRR 98 T +L RW K A+K L FKKE+ + + +NRR Sbjct 62 TRAVLDRWRGVNKQTAMKHLLSFKKELGTLTSAINRR 98 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Japanese encephalitis virus strain SA-14] Sequence ID: P27395.1 Length: 3432 Range 1: 3 to 100 Score:75.1 bits(183), Expect:5e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Japanese encephalitis virus strain SA(V)] Sequence ID: P19110.1 Length: 3432 Range 1: 3 to 100 Score:75.1 bits(183), Expect:5e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Japanese encephalitis virus strain JAOARS982] Sequence ID: P32886.1 Length: 3432 Range 1: 3 to 100 Score:75.1 bits(183), Expect:5e-16, Method:Composition-based stats., Identities:39/99(39%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R R Sbjct 62 TKALLGRWKAVEKSVAMKHLTSFKRELGTLIDAVNKRGR 100 >RecName: Full=Structural polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1'; Short=NS1' [Japanese encephalitis virus strain M28] Sequence ID: P0DOK8.1 Length: 1198 Range 1: 3 to 100 Score:74.3 bits(181), Expect:8e-16, Method:Composition-based stats., Identities:38/99(38%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R + Sbjct 62 TKALLGRWRAVEKSVAMKHLTSFKRELGTLIDAVNKRGK 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Murray valley encephalitis virus (strain MVE-1-51)] Sequence ID: P05769.2 Length: 3434 Range 1: 3 to 96 Score:73.6 bits(179), Expect:2e-15, Method:Composition-based stats., Identities:39/95(41%), Positives:56/95(58%), Gaps:5/95(5%) Query 6 KKTGRPS----FNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P NMLKR RV + + KR LL G+GP++ V+A +AF RF A+ P Sbjct 3 KKPGGPGKPRVVNMLKRGIPRVFPLVGV-KRVVMNLLDGRGPIRFVLALLAFFRFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMN 96 T ++ RW S K A+K L FKKE+ +++++N Sbjct 62 TKALMRRWKSVNKTTAMKHLTSFKKELGTLIDVVN 96 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Japanese encephalitis virus strain M28] Sequence ID: G3FEX6.1 Length: 3432 Range 1: 3 to 100 Score:73.2 bits(178), Expect:2e-15, Method:Composition-based stats., Identities:38/99(38%), Positives:60/99(60%), Gaps:5/99(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR RV + + KR LL G+GP++ V+A I F +F A+ P Sbjct 3 KKPGGPGKNRAINMLKRGLPRVFPLVGV-KRVVMSLLDGRGPVRFVLALITFFKFTALAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKR 100 T +L RW + +K+ A+K L FK+E+ +++ +N+R + Sbjct 62 TKALLGRWRAVEKSVAMKHLTSFKRELGTLIDAVNKRGK 100 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease/Helicase NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=NS5 [West Nile virus] Sequence ID: P06935.2 Length: 3430 Range 1: 3 to 98 Score:73.2 bits(178), Expect:2e-15, Method:Composition-based stats., Identities:41/97(42%), Positives:56/97(57%), Gaps:5/97(5%) Query 6 KKTGRP----SFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPP 61 KK G P + NMLKR R ++ L KR L+ G+GP++ V+A +AF RF AI P Sbjct 3 KKPGGPGKNRAVNMLKRGMPRGLSLIGL-KRAMLSLIDGKGPIRFVLALLAFFRFTAIAP 61 Query 62 TAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRR 98 T +L RW K A+K L FKKE+ + + +NRR Sbjct 62 TRAVLDRWRGVNKQTAMKHLLSFKKELGTLTSAINRR 98 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Rocio virus] Sequence ID: Q32ZD4.1 Length: 3425 Range 1: 10 to 98 Score:70.5 bits(171), Expect:2e-14, Method:Composition-based stats., Identities:50/91(55%), Positives:62/91(68%), Gaps:2/91(2%) Query 9 GRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPTAGILAR 68 GR NMLKR + VS + + KR L G+GP+++V+AFIAF RF AI PT G+L R Sbjct 10 GRRVVNMLKRPAS-VSPIKGI-KRLIGNLTDGRGPLRVVLAFIAFFRFAAIMPTQGLLRR 67 Query 69 WGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 W K+ A+K L FKKEISNMLNI+NRRK Sbjct 68 WRVMNKSEALKHLTSFKKEISNMLNIINRRK 98 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Capsid protein C; AltName: Full=Core protein; Contains: RecName: Full=Protein prM; Contains: RecName: Full=Peptide pr; Contains: RecName: Full=Small envelope protein M; AltName: Full=Matrix protein; Contains: RecName: Full=Envelope protein E; Contains: RecName: Full=Non-structural protein 1; Short=NS1; Contains: RecName: Full=Non-structural protein 2A; Short=NS2A; Contains: RecName: Full=Serine protease subunit NS2B; AltName: Full=Flavivirin protease NS2B regulatory subunit; AltName: Full=Non-structural protein 2B; Contains: RecName: Full=Serine protease NS3; AltName: Full=Flavivirin protease NS3 catalytic subunit; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Peptide 2k; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=RNA-directed RNA polymerase/Methyltransferase NS5; AltName: Full=Non-structural protein 5 [Ilheus virus] Sequence ID: Q32ZD7.1 Length: 3424 Range 1: 7 to 97 Score:69.7 bits(169), Expect:4e-14, Method:Composition-based stats., Identities:37/94(39%), Positives:54/94(57%), Gaps:3/94(3%) Query 6 KKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPTAGI 65 K + + NMLKR S +R + +L +G +L++A +AF RF AI PT G+ Sbjct 7 KSAAKRTVNMLKRL---ASVSPSRGRRTIRRMLDVRGAPRLILALMAFFRFAAIKPTLGL 63 Query 66 LARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRK 99 RW S K A+K L FKKE++ ML+ +N+RK Sbjct 64 KKRWRSVNKTVAVKHLTNFKKELTTMLDSVNKRK 97