Название вида: Drosophila melanogaster (Дрозофила фруктовая)
Число сборок генома: 22, мною выбрана сборка с Assembly - GCA_000001215.4
Общая длина: 143,726,002
Число контигов: 2,442; скэффолдов: 1,870
Scaffold N50: 25,286,936; Contig N50: 21,485,538;
Scaffold L50: 3; Contig L50: 3
Число аннотированных белков:
Ссылка на публикацию с описанием проекта
Ссылка на последовательность одного из контигов
| Ключ | Описание | Пример |
|---|---|---|
| assembly_gap | Gap between two components of a genome or transcriptome assembly | |
| CDS | coding sequence | CDS 109..717 /gene="sod" /EC_number="1.15.1.1" /codon_start=1 /transl_table=11 /product="superoxide dismutase" /db_xref="GI:44011" /db_xref="GOA:P28763" /db_xref="InterPro:IPR001189" /db_xref="UniProtKB/Swiss-Prot:P28763" /protein_id="CAA45406.1" /translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAVS GHAELASKPGEELVANLDSVPEEIRGAVRNHGGGHANHTLFWSSLSPNGGGAPTGNLK AAIESEFGTFDEFKEKFNAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPV LGLDVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK" |
| source | identifies the biological source of the specified span of the sequence | source 1..756
/organism="Listeria ivanovii"
/strain="ATCC 19119"
/db_xref="taxon:1638"
/mol_type="genomic DNA" |
| exon | region of genome that codes for portion of spliced mRNA | exon complement(4223..4554) /gene="cox1" /locus_tag="AnruMp01" /number=4 |
| gap | gap in the sequence | |
| gene | region of biological interest identified as a gene and for which a name has been assigned | gene 95..746 /gene="sod" |
| intron | a segment of DNA that is transcribed, but removed from within the transcript by splicing together the sequences (exons) on either side of it | intron complement(2169..4222) /gene="cox1" /locus_tag="AnruMp01" /number=4 /note="group II intron" |
«Проект 100 000 геномов» выполняется Государственной службой здравоохранения Великобритании для пациентов из Англии в период между 2015 и 2018 гг. Его цель – выявление общих генетических черт, лежащих в основе ряда форм рака и редких наследственных заболеваний.
Текст запроса(ENA): tax_tree(3208) AND mol_type="genomic DNA" AND topology="CIRCULAR" AND organelle="mitochondrion"
Update: 3 results found; Release: 44 results found
Организм: Anomodon rugelii (Аномодон Регеля); AC: JF973314
Таблица генов белков