TBLASTN 2.2.15 [Oct-15-2006] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= YBEY_ECOLI P0A898 RecName: Full=Putative metalloprotease ybeY; EC=3.4.24.-; (155 letters) Database: xc 460 sequences; 5,103,728 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE012341 AE008922 |AE012341| Xanthomonas campestris pv. campestr... 130 9e-32 >AE012341 AE008922 |AE012341| Xanthomonas campestris pv. campestris str. ATCC 33913, section 249 of 460 of the complete genome. Length = 10478 Score = 130 bits (326), Expect = 9e-32 Identities = 68/143 (47%), Positives = 86/143 (60%), Gaps = 4/143 (2%) Frame = +3 Query: 16 SGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESHSLNLTYRGKDKPTNVLSFPFEVP 75 +GLP F+ W+ A + E+++ +RVVD E SLN YRGKD TNVLSFP E+P Sbjct: 1149 TGLPSSVSFRKWVAAALKGRIREADLAVRVVDEKEGCSLNHHYRGKDYATNVLSFPAEMP 1328 Query: 76 PGM----EMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHXXXXXXX 131 G+ +M LLGDLVIC VV +EA EQGK L AH+AH+ VHG+LHLLG+DH Sbjct: 1329 QGLPKGVKMPLLGDLVICAPVVAREAAEQGKSLSAHYAHLTVHGTLHLLGWDHEDDKEAD 1508 Query: 132 XXXXXXXXXXXALGYEDPYIAEK 154 LG +DPY E+ Sbjct: 1509 AMEQLEREILAELGIDDPYAGER 1577 Database: xc Posted date: Nov 3, 2008 2:24 AM Number of letters in database: 5,103,728 Number of sequences in database: 460 Lambda K H 0.316 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 460 Number of Hits to DB: 808,362 Number of extensions: 10309 Number of successful extensions: 47 Number of sequences better than 1.0e-03: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 1 Length of query: 155 Length of database: 1,701,242 Length adjustment: 79 Effective length of query: 76 Effective length of database: 1,664,902 Effective search space: 126532552 Effective search space used: 126532552 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)