This is a result of script 'evolve_protein.pl', version 1.0
Output is created at: Sun Aug 25 23:05:05 2013

----------- Script parameters -----------
<    DEFAULT VALUE    > Probability of residue change =	0.4
<    DEFAULT VALUE    > Probability of residue replacement =	0.8
<                     > Probability of insertion =	0.100
<                     > Probability of deletion =	0.100
Number of residues taken from resulting sequence =	20
Number of sequences to generate =	1
Number of generations for each sequence =	1
-----------------------------------------

Input FASTA data and resulting sequences as follows:
>sp|P19079|CDD_BACSU Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1
MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDLHDERKL

>0|simulation_result|change=0.4|replace=0.8|generations=1
RSALFKAMSYPDTENFCQML