TBLASTN 2.8.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome_.fasta 1 sequences; 1,584,804 total letters Query= Aac1023ORF14055P Length=223 ***** No hits found ***** Lambda K H a alpha 0.322 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 77644224 Query= AccII Length=354 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 144723512 Query= Acy7122ORF4944P Length=197 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Acy7122ORF930P Length=264 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= Aeq19450ORF2084P Length=275 ***** No hits found ***** Lambda K H a alpha 0.319 0.132 0.376 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104053430 Query= Afa22MI Length=259 ***** No hits found ***** Lambda K H a alpha 0.323 0.141 0.412 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 95602390 Query= Afl2012ORF8205P Length=265 ***** No hits found ***** Lambda K H a alpha 0.318 0.133 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Afl81ORFDP Length=197 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Afl81ORFWP Length=183 ***** No hits found ***** Lambda K H a alpha 0.319 0.134 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 57573146 Query= Ala17612ORFEP Length=239 ***** No hits found ***** Lambda K H a alpha 0.316 0.131 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 85566942 Query= Ama55IP Length=260 ***** No hits found ***** Lambda K H a alpha 0.324 0.139 0.434 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96130580 Query= AmaCSORF3349P Length=267 ***** No hits found ***** Lambda K H a alpha 0.322 0.140 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99827910 Query= AmaCSORF5682P Length=178 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 54932176 Query= AplC1ORF50840P Length=322 ***** No hits found ***** Lambda K H a alpha 0.322 0.136 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127821496 Query= AplORF8920P Length=270 ***** No hits found ***** Lambda K H a alpha 0.322 0.138 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= AplPORF10790P Length=270 ***** No hits found ***** Lambda K H a alpha 0.322 0.138 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= AplYZORF3865P Length=283 ***** No hits found ***** Lambda K H a alpha 0.322 0.137 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Asc27420ORF4765P Length=265 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Asp11108ORF15580P Length=279 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= Asp231ORF7059P Length=266 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99299720 Query= Asp283ORF9195P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Asp2985ORFAP Length=291 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 111976068 Query= Asp33047ORFGP Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Asp43ORFGP Length=90 ***** No hits found ***** Lambda K H a alpha 0.319 0.134 0.384 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13733304 Query= Asp43ORFKP Length=279 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= Asp7108ORFHP Length=264 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= Asp7108ORFQP Length=324 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128877872 Query= Asp8005ORF11170P Length=322 ***** No hits found ***** Lambda K H a alpha 0.322 0.136 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127821496 Query= Asp8005ORF30353P Length=278 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 33.9 0.006 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 33.9 bits (76), Expect = 0.006, Method: Compositional matrix adjust. Identities = 20/66 (30%), Positives = 34/66 (52%), Gaps = 1/66 (2%) Frame = +1 Query 209 AMPYNPWGKLENYKWSVAKKYLPFDDTVLVGDQFWTVIGGEGTYEEVLSIYLEVGRDMEK 268 A+ YNP+ +W + + L D+ + V +FW +G GTY E+L + VG ++ Sbjct 414895 AISYNPYEPQPYNRW-IMRGMLNIDN*LKVASEFWDFLGRIGTYLELLDCFERVGIELRP 415071 Query 269 SILDQL 274 I + L Sbjct 415072 EIDNYL 415089 Lambda K H a alpha 0.318 0.133 0.378 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 105638000 Query= AspLS16ORF15690P Length=276 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104581620 Query= AspNIH1IIIP Length=344 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 139441632 Query= AspNIH4IP Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= AspSLV7IVP Length=308 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 120955281 Query= AspWA102ORF25305P Length=265 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Ava23ORF47310P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= AvaII Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= BagMCEORFBP Length=265 ***** No hits found ***** Lambda K H a alpha 0.322 0.137 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Bal380ORF19490P Length=345 ***** No hits found ***** Lambda K H a alpha 0.315 0.133 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 139969820 Query= Bam1267ORF3424P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= Bam942ORF6125P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamFI Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamHI Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamHK1ORF2373P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamLL3ORF3413P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamTA208IP Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BamXH7ORF3402P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= Ban10140ORF34P Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= Ban2459ORFBP Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= Ban52ORF170P Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= Ban603ORF170P Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= Ban7ORF31P Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= BanA6ORF29P Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= BanLIIP Length=317 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125708982 Query= Baz2011ORF4530P Length=282 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107750760 Query= Bba15883ORF2124P Length=354 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 144723512 Query= BbrF4563ORF5176P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Bce4077ORF3576P Length=229 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.387 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 80813376 Query= Bce4118ORF3753P Length=353 ***** No hits found ***** Lambda K H a alpha 0.314 0.133 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 144195324 Query= BceFT9ORF3558P Length=264 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.390 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= BceSII Length=264 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.390 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= BceVD62ORF20P Length=346 ***** No hits found ***** Lambda K H a alpha 0.313 0.134 0.373 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 140498008 Query= BceVDM21ORF4869P Length=269 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Bcl12056ORF1456P Length=351 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 143138948 Query= BcoB425ORF3796P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= Bcy2833ORF18130P Length=264 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= BfaDORF26030P Length=271 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101940670 Query= Bgl2196IIIP Length=283 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= BglBGRORF16100P Length=283 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Bhi3425ORF21795P Length=300 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Bma25957ORFAP Length=350 ***** No hits found ***** Lambda K H a alpha 0.317 0.133 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142610760 Query= Bps15342ORF928P Length=276 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104581620 Query= Bps5008ORF863P Length=276 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104581620 Query= BpsBFDORF1350P Length=236 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.439 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 83982369 Query= BpuB4133ORF2736P Length=349 ***** No hits found ***** Lambda K H a alpha 0.314 0.134 0.373 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142082572 Query= Bsp98I Length=199 ***** No hits found ***** Lambda K H a alpha 0.315 0.134 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 65495932 Query= BspPSORF3556P Length=302 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117786147 Query= Bsu125ORF2405P Length=284 ***** No hits found ***** Lambda K H a alpha 0.318 0.140 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108807140 Query= Bsu13952ORF16390P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= BsuBSP1ORF1060P Length=284 ***** No hits found ***** Lambda K H a alpha 0.318 0.140 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108807140 Query= BsuBSP1ORFAP Length=284 ***** No hits found ***** Lambda K H a alpha 0.318 0.140 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108807140 Query= Bth1002ORF2998P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= Bth4222ORF8220P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= Bth4Q7ORF13975P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= Bth6552ORF4925P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= Bth789ORF2340P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= Bth81934ORFAP Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= BthBR58ORF25460P Length=272 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102468860 Query= BthTXORFEP Length=78 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.453 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205375 Query= Bve5007ORF2981P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= Bve5044ORF2982P Length=213 ***** No hits found ***** Lambda K H a alpha 0.315 0.135 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362304 Query= Cae357ORF17920P Length=309 ***** No hits found ***** Lambda K H a alpha 0.317 0.135 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 121483470 Query= CagORF2240P Length=283 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Cap10605ORF2460P Length=268 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100356100 Query= Car11915ORFDP Length=303 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 118314336 Query= CbaCHKC6ORF1085P Length=359 ***** No hits found ***** Lambda K H a alpha 0.317 0.135 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 146835986 Query= CboBfORF47P Length=261 ***** No hits found ***** Lambda K H a alpha 0.314 0.134 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= Cep9333ORF3880P Length=284 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 37.0 7e-04 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 37.0 bits (84), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Frame = +1 Query 193 SYFALPYNPYGKKEDYKWSFPSRWFNMQQDEVVLIGNEFWDKIGGVGTYQAFIKAVNEIG 252 + A+ YNPY + +W + D + + +EFWD +G +GTY + +G Sbjct 414886 TLIAISYNPYEPQPYNRWIMRGM---LNIDN*LKVASEFWDFLGRIGTYLELLDCFERVG 415056 Query 253 QEYRERI 259 E R I Sbjct 415057 IELRPEI 415077 Lambda K H a alpha 0.317 0.136 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108807140 Query= CfrA41ORFDP Length=189 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 60742310 Query= CfrA41ORFFP Length=276 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104581620 Query= CfrA41ORFHP Length=149 ***** No hits found ***** Lambda K H a alpha 0.321 0.141 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 41199366 Query= CfrA41ORFIP Length=266 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99299720 Query= CfrA41ORFKP Length=243 ***** No hits found ***** Lambda K H a alpha 0.322 0.140 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 87679706 Query= Cli5388ORF240P Length=367 ***** No hits found ***** Lambda K H a alpha 0.317 0.135 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 151061482 Query= Cmi6605ORF3188P Length=266 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99299720 Query= Cpa150ORF2840P Length=296 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114617013 Query= Cpa525ORF2840P Length=296 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114617013 Query= CpaAI Length=296 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114617013 Query= CpeAIIP Length=274 ***** No hits found ***** Lambda K H a alpha 0.313 0.134 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 103525240 Query= Csa148ORF14015P Length=305 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Csa632ORF17425P Length=305 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Csa8399ORFBP Length=303 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 118314336 Query= Csa894ORF6561P Length=324 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128877872 Query= Csp1100ORF230P Length=305 ***** No hits found ***** Lambda K H a alpha 0.316 0.133 0.388 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Csp51472ORF1756P Length=387 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.375 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 161625222 Query= Csp51472ORF2367P Length=233 ***** No hits found ***** Lambda K H a alpha 0.319 0.133 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82926144 Query= Csp68KI Length=233 ***** No hits found ***** Lambda K H a alpha 0.319 0.133 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82926144 Query= Csp68KVI Length=387 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.375 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 161625222 Query= Csp7424ORF4169P Length=282 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107750760 Query= Csp7507ORF4224P Length=209 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 70777862 Query= Csp7822ORF2010P Length=197 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Csp7822ORF584P Length=197 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Csp8801ORF4296P Length=195 ***** No hits found ***** Lambda K H a alpha 0.315 0.133 0.380 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 63383160 Query= Csp8801ORF84P Length=256 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 94546189 Query= Csp8802ORF4356P Length=280 ***** No hits found ***** Lambda K H a alpha 0.317 0.137 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106694380 Query= CspCCYORF7981P Length=233 ***** No hits found ***** Lambda K H a alpha 0.318 0.132 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82926144 Query= CspCR12ORF15870P Length=223 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.381 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 77644224 Query= CspM240ORF2933P Length=270 ***** No hits found ***** Lambda K H a alpha 0.316 0.136 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= Cst7417ORF1014P Length=211 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71834248 Query= Cte5398ORF3271P Length=260 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96130580 Query= Cth7203ORF5416P Length=246 ***** No hits found ***** Lambda K H a alpha 0.318 0.133 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 89264279 Query= Cwa3ORF4123P Length=209 ***** No hits found ***** Lambda K H a alpha 0.316 0.136 0.372 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 70777862 Query= CwaWHORF2014P Length=209 ***** No hits found ***** Lambda K H a alpha 0.316 0.137 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 70777862 Query= DdsI Length=201 ***** No hits found ***** Lambda K H a alpha 0.320 0.140 0.433 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 66552318 Query= DolHORF939P Length=135 ***** No hits found ***** Lambda K H a alpha 0.320 0.140 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 34332870 Query= Dsa8305ORF3149P Length=258 ***** No hits found ***** Lambda K H a alpha 0.319 0.139 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 95602571 Query= Dsa8305ORF749P Length=280 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106694380 Query= Dsu10523ORF3605P Length=202 ***** No hits found ***** Lambda K H a alpha 0.317 0.136 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67080511 Query= Dze3532ORFBP Length=226 ***** No hits found ***** Lambda K H a alpha 0.318 0.131 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 79228800 Query= EagI Length=301 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Eal11588ORFCP Length=230 ***** No hits found ***** Lambda K H a alpha 0.314 0.129 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Eco47I Length=230 ***** No hits found ***** Lambda K H a alpha 0.314 0.129 0.372 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Eco47IA Length=133 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 33276474 Query= Eco47IB Length=119 ***** No hits found ***** Lambda K H a alpha 0.314 0.128 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 26938200 Query= Eco7011ORFHP Length=230 ***** No hits found ***** Lambda K H a alpha 0.314 0.129 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Elo6997ORF2955P Length=264 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= Ema16307ORFCP Length=342 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 138385256 Query= Enu25634ORFCP Length=312 ***** No hits found ***** Lambda K H a alpha 0.316 0.133 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 123068037 Query= EsaBFORFEP Length=223 ***** No hits found ***** Lambda K H a alpha 0.314 0.133 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 77644224 Query= EsaCFORFCP Length=143 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 38030184 Query= EsaCMIIORFEP Length=175 ***** No hits found ***** Lambda K H a alpha 0.315 0.132 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 53875890 Query= EsaDCORFHP Length=191 ***** No hits found ***** Lambda K H a alpha 0.311 0.128 0.368 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 61798698 Query= EsaFIORFWP Length=207 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 69721476 Query= EsaGMORFJP Length=75 ***** No hits found ***** Lambda K H a alpha 0.314 0.129 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205450 Query= EsaGPORFGP Length=178 ***** No hits found ***** Lambda K H a alpha 0.316 0.133 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 54932176 Query= EsaMIORFBP Length=269 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 47.0 4e-07 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 47.0 bits (110), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 1/62 (2%) Frame = +1 Query 194 VKTYFAMAYNPYGTRADYTHGFATQHLDMKNQVLIQEEFWDIVGGAGTYKELLDIYLEVG 253 + T A++YNPY + Y L++ N + + EFWD +G GTY ELLD + VG Sbjct 414880 ISTLIAISYNPYEPQP-YNRWIMRGMLNIDN*LKVASEFWDFLGRIGTYLELLDCFERVG 415056 Query 254 RE 255 E Sbjct 415057 IE 415062 Lambda K H a alpha 0.320 0.137 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= EsaMIORFFP Length=279 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= EsaPCHORFAP Length=216 ***** No hits found ***** Lambda K H a alpha 0.316 0.131 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 73946880 Query= EsaPCHORFGP Length=188 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 60214116 Query= EsaPCHORFRP Length=268 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.378 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100356100 Query= EsaRM67P Length=210 ***** No hits found ***** Lambda K H a alpha 0.317 0.138 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71306055 Query= EsaSS120P Length=92 ***** No hits found ***** Lambda K H a alpha 0.324 0.138 0.475 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 14789712 Query= EsaSS1490P Length=218 ***** No hits found ***** Lambda K H a alpha 0.312 0.130 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 75003264 Query= EsaSS1817P Length=163 ***** No hits found ***** Lambda K H a alpha 0.313 0.132 0.390 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 47537550 Query= EsaSS1978P Length=194 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62854967 Query= EsaSS559P Length=189 ***** No hits found ***** Lambda K H a alpha 0.316 0.132 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 60742310 Query= EsaYCORFJP Length=597 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 270429696 Query= Fli6794ORF2209P Length=291 ***** No hits found ***** Lambda K H a alpha 0.316 0.133 0.375 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 111976068 Query= FplHORF1586P Length=220 ***** No hits found ***** Lambda K H a alpha 0.318 0.138 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 76059648 Query= Fps101ORF7545P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps11754ORF7035P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps11ORF3915P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps17830ORF6380P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps3ORF4080P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps5ORF4360P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Fps93ORF1519P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsFPCH6ORF7955P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsJVP Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsMH1ORF4365P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsPG2ORF4375P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsPuORF5415P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV120ORF4020P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV220ORF3420P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV35ORF4005P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV424ORF3920P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV428ORF4005P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsV433ORF3955P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FpsVQ50ORF4080P Length=294 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= FspJSC11ORF3231P Length=268 ***** No hits found ***** Lambda K H a alpha 0.319 0.132 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100356100 Query= FssI Length=234 ***** No hits found ***** Lambda K H a alpha 0.317 0.132 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82925987 Query= Fsu85ORF930P Length=234 ***** No hits found ***** Lambda K H a alpha 0.317 0.132 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82925987 Query= GfeIRF9ORF26490P Length=200 ***** No hits found ***** Lambda K H a alpha 0.318 0.139 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 66024125 Query= Gma30ORFCP Length=304 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 118842525 Query= GpeYA1ORFAP Length=302 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117786147 Query= Gsp7428ORF2669P Length=197 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= GspWCHORF3472P Length=268 ***** No hits found ***** Lambda K H a alpha 0.314 0.135 0.380 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100356100 Query= Gst4109ORF3106P Length=294 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= HauORF2756P Length=198 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64967739 Query= Hby512170ORF9775P Length=85 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205200 Query= HchORF2488P Length=207 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 69721476 Query= HciD43ORFHP Length=275 ***** No hits found ***** Lambda K H a alpha 0.317 0.136 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104053430 Query= HgeGC42ORF13415P Length=271 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 40.8 3e-05 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 40.8 bits (94), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 22/81 (27%), Positives = 38/81 (47%), Gaps = 2/81 (2%) Frame = +1 Query 190 AIKQQSAIPINAFYAMAYNPWGANRASYTYSMVKKYTDFTNAVVIGQEFWSLIGEPSTYT 249 ++ I I+ A++YNP+ Y +++ + N + + EFW +G TY Sbjct 414853 SLASNPTI*ISTLIAISYNPYEPQ--PYNRWIMRGMLNIDN*LKVASEFWDFLGRIGTYL 415026 Query 250 ELLEIYREVGLSKSSEITQKL 270 ELL+ + VG+ EI L Sbjct 415027 ELLDCFERVGIELRPEIDNYL 415089 Lambda K H a alpha 0.320 0.135 0.387 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101940670 Query= HgiBI Length=274 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 42.0 2e-05 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 42.0 bits (97), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/81 (26%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +1 Query 192 TIKQQSAVPVKAFYAMAYNPWGISRASYRSSITKKYTDFSNAVVIGQEFWSLIGEPSTYT 251 ++ + + A++YNP+ Y I + + N + + EFW +G TY Sbjct 414853 SLASNPTI*ISTLIAISYNPY--EPQPYNRWIMRGMLNIDN*LKVASEFWDFLGRIGTYL 415026 Query 252 ELLEIYHEVGLAKSAEITQKL 272 ELL+ + VG+ EI L Sbjct 415027 ELLDCFERVGIELRPEIDNYL 415089 Lambda K H a alpha 0.319 0.133 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 103525240 Query= HgiCII Length=273 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 43.5 5e-06 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 43.5 bits (101), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 23/81 (28%), Positives = 38/81 (47%), Gaps = 2/81 (2%) Frame = +1 Query 192 AIKQNSTLPTHAFYAMAYNPWGANRASYTYSIVKKYTDFTNAVVIGQEFWSLIGESSTYT 251 ++ N T+ A++YNP+ Y I++ + N + + EFW +G TY Sbjct 414853 SLASNPTI*ISTLIAISYNPYEPQ--PYNRWIMRGMLNIDN*LKVASEFWDFLGRIGTYL 415026 Query 252 ELLEIYREVGLSKSSEITKKL 272 ELL+ + VG+ EI L Sbjct 415027 ELLDCFERVGIELRPEIDNYL 415089 Lambda K H a alpha 0.319 0.133 0.381 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102997050 Query= HgiEI Length=274 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 38.9 2e-04 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 38.9 bits (89), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/81 (25%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +1 Query 192 TIKQQSAVPVKAFYAMAYNPWGISRASYRSSNTKKYTDFSNAVVIGQEFWSLIGEPSTYT 251 ++ + + A++YNP+ Y + + N + + EFW +G TY Sbjct 414853 SLASNPTI*ISTLIAISYNPY--EPQPYNRWIMRGMLNIDN*LKVASEFWDFLGRIGTYL 415026 Query 252 ELLEIYHEVGLAKSAEITQKL 272 ELL+ + VG+ EI L Sbjct 415027 ELLDCFERVGIELRPEIDNYL 415089 Lambda K H a alpha 0.320 0.134 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 103525240 Query= Hin1394ORF430P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin1974ORF6095P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin1980ORF4080P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin1988ORF8325P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin2004ORF8450P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin2114ORF8795P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin2846ORF1064P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin345ORF3140P Length=165 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 48593940 Query= Hin412602ORF1179P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin64ORF4545P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin723ORF1797P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hin86ORF1460P Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= HinEEORF5555P Length=355 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= HinR2846ORFAP Length=380 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 157927913 Query= Hpa15995ORF2059P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= Hpa29755ORF1909P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= Hpa318ORF4590P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= Hpa33ORF2282P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= Hpa906ORF8095P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= HpaSH03ORF7010P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= HpaSHORF2119P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= HpaST41ORF8905P Length=355 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 145251700 Query= Hps1084ORF11785P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Hpy13AORF6920P Length=204 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy13ORF6925P Length=204 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy21ORF1326P Length=204 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy4ORF6890P Length=60 ***** No hits found ***** Lambda K H a alpha 0.319 0.134 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205825 Query= Hpy5026ORF9290P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy5056ORF2310P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy70ORF1374P Length=204 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hpy84ORF7440P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyF75ORF1349P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyFD535ORFOP Length=204 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyJ05ORF7235P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyMKF3ORF1342P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyMKM1ORF1324P Length=204 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyMKM5ORF1339P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpySA20ORF1680P Length=204 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyUM038ORF8495P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= HpyUM065ORF7835P Length=204 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68136897 Query= Hsp1ORF15605P Length=174 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 53347695 Query= Ibu211ORF1581P Length=261 ***** No hits found ***** Lambda K H a alpha 0.322 0.138 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= Jsp2502ORF10650P Length=363 ***** No hits found ***** Lambda K H a alpha 0.316 0.134 0.375 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 148948734 Query= JspCORF2889P Length=341 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 137857068 Query= KinAF2ORF203299P Length=301 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Kpn1088ORFAP Length=203 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67608704 Query= Kpn48ORFAP Length=269 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Kpn570ORFAP Length=269 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Kpn822917ORF29280P Length=269 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Lam20533ORF5260P Length=348 ***** No hits found ***** Lambda K H a alpha 0.317 0.135 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 141554384 Query= Lga113ORFAP Length=362 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 148420547 Query= LplBR5ORF393P Length=262 ***** No hits found ***** Lambda K H a alpha 0.313 0.130 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97186960 Query= LspO77ORF3608P Length=135 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 34332870 Query= LspO77ORF4567P Length=295 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114088824 Query= LspO77ORF4591P Length=157 ***** No hits found ***** Lambda K H a alpha 0.319 0.134 0.431 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 44896660 Query= LspP13C2ORF18665P Length=263 ***** No hits found ***** Lambda K H a alpha 0.316 0.130 0.376 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97715150 Query= LspZV013ORF12810P Length=202 ***** No hits found ***** Lambda K H a alpha 0.318 0.141 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67080511 Query= LspZV016ORF10250P Length=202 ***** No hits found ***** Lambda K H a alpha 0.318 0.141 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67080511 Query= Mae7806ORF260P Length=259 ***** No hits found ***** Lambda K H a alpha 0.317 0.134 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 95602390 Query= Mae843ORF28780P Length=255 ***** No hits found ***** Lambda K H a alpha 0.317 0.134 0.370 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 94017998 Query= Mae98ORF6P Length=71 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205550 Query= MalHORF22563P Length=304 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 118842525 Query= MblMV1ORF1355P Length=314 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.431 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 124124415 Query= Mbo57922ORF8810P Length=347 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 141026196 Query= Mbo58086ORF8455P Length=347 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 141026196 Query= Mca12ORF1154P Length=288 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110391501 Query= Mca353ORF1670P Length=288 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110391501 Query= Mca7169ORF9240P Length=279 ***** No hits found ***** Lambda K H a alpha 0.317 0.133 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= McaBC1ORF8785P Length=288 ***** No hits found ***** Lambda K H a alpha 0.316 0.132 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110391501 Query= McaLVORF2695P Length=282 ***** No hits found ***** Lambda K H a alpha 0.323 0.140 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107750760 Query= McaPG14ORF743P Length=282 ***** No hits found ***** Lambda K H a alpha 0.323 0.141 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107750760 Query= Mch7420ORF1590P Length=265 ***** No hits found ***** Lambda K H a alpha 0.317 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Mch7420ORF4872P Length=279 ***** No hits found ***** Lambda K H a alpha 0.317 0.133 0.378 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= MgoSA37ORFAP Length=264 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= Mho15517ORFDP Length=288 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 35.8 0.002 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 35.8 bits (81), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +1 Query 187 PPLVDNAYFALPYNPYGSRENYSWSFPARWFDMKHDDVVLIGDEFWDTIGGAGTYTAFIS 246 P + + A+ YNPY + W + D+ + + EFWD +G GTY + Sbjct 414868 PTI*ISTLIAISYNPYEPQPYNRWIMRGM---LNIDN*LKVASEFWDFLGRIGTYLELLD 415038 Query 247 AINEIGAEYKERI 259 +G E + I Sbjct 415039 CFERVGIELRPEI 415077 Lambda K H a alpha 0.319 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110391501 Query= Mko49807ORF8665P Length=199 ***** No hits found ***** Lambda K H a alpha 0.317 0.135 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 65495932 Query= Mli2279ORF2953P Length=289 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 35.0 0.003 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 35.0 bits (79), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/73 (25%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +1 Query 187 PSVIDGAYFALPYNPYGTRENYSWSFPARWFDMKNDEVVLIGNDFWDYIGGKGTYEAFIS 246 P++ A+ YNPY + W + D + + ++FWD++G GTY + Sbjct 414868 PTI*ISTLIAISYNPYEPQPYNRWIMRGM---LNIDN*LKVASEFWDFLGRIGTYLELLD 415038 Query 247 AVNEIGPKYREKI 259 +G + R +I Sbjct 415039 CFERVGIELRPEI 415077 Lambda K H a alpha 0.317 0.137 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110919690 Query= MmaMP1X4ORF4352P Length=283 ***** No hits found ***** Lambda K H a alpha 0.321 0.136 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Mmo22980ORF210P Length=265 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= MpoORF1847P Length=265 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Mru1279ORF2712P Length=195 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 63383160 Query= MruH328ORFLP Length=216 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 73946880 Query= MspEVN1ORF13295P Length=220 ***** No hits found ***** Lambda K H a alpha 0.317 0.131 0.387 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 76059648 Query= MspM1ORF5850P Length=291 ***** No hits found ***** Lambda K H a alpha 0.315 0.133 0.382 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 111976068 Query= MspOH31ORFBP Length=273 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102997050 Query= Mst14675ORF4133P Length=222 ***** No hits found ***** Lambda K H a alpha 0.323 0.140 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 77116032 Query= Mtr4126ORF2143P Length=360 ***** No hits found ***** Lambda K H a alpha 0.317 0.136 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 147364173 Query= MvaFGP2ORF1415P Length=197 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= MvaSBORF1633P Length=372 ***** No hits found ***** Lambda K H a alpha 0.315 0.133 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 153702417 Query= Mvi102ORF4900P Length=255 ***** No hits found ***** Lambda K H a alpha 0.317 0.134 0.370 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 94017998 Query= NgrSP2ORF1531P Length=250 ***** No hits found ***** Lambda K H a alpha 0.314 0.136 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 91377043 Query= NhoORF2210028P Length=202 ***** No hits found ***** Lambda K H a alpha 0.318 0.139 0.435 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67080511 Query= Npi21ORF11410P Length=197 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= NpuORF2563P Length=295 ***** No hits found ***** Lambda K H a alpha 0.322 0.136 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114088824 Query= Nsp3756ORF35390P Length=197 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Nsp9414ORF34170P Length=277 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 35.0 0.003 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 35.0 bits (79), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/77 (30%), Positives = 36/77 (47%), Gaps = 3/77 (4%) Frame = +1 Query 182 LAMNPTVVDYAYYALPYNPYGKKENYKWTFPMRWFNMYEDESVLIGDEFWELIGGEGTYS 241 LA NPT+ A+ YNPY + +W MR + D + + EFW+ +G GTY Sbjct 414856 LASNPTI*ISTLIAISYNPYEPQPYNRWI--MRGM-LNIDN*LKVASEFWDFLGRIGTYL 415026 Query 242 NFIKEINVLGKDYKERI 258 + +G + + I Sbjct 415027 ELLDCFERVGIELRPEI 415077 Lambda K H a alpha 0.318 0.137 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 105109810 Query= NspPP1YORF3725P Length=259 ***** No hits found ***** Lambda K H a alpha 0.323 0.140 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 95602390 Query= ObaBS6ORF8960P Length=136 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 34861068 Query= Ocy1ORF10530P Length=267 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99827910 Query= Ocy1ORF4640P Length=265 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Oni7112ORF5427P Length=279 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 35.0 0.003 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 35.0 bits (79), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +1 Query 209 AMAYNPYGPNRSDYKWSAARKYTPFEQAVIMGDEFWNIIGGETAYEELLDIYQEVGRE 266 A++YNPY P + +W R + + + EFW+ +G Y ELLD ++ VG E Sbjct 414895 AISYNPYEPQPYN-RW-IMRGMLNIDN*LKVASEFWDFLGRIGTYLELLDCFERVGIE 415062 Lambda K H a alpha 0.318 0.134 0.381 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= OtrDG6ORFAP Length=219 ***** No hits found ***** Lambda K H a alpha 0.323 0.139 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 75531456 Query= OulORF1191P Length=315 ***** No hits found ***** Lambda K H a alpha 0.322 0.138 0.428 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 124652604 Query= Ova1820ORF30340P Length=210 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71306055 Query= Pae445ORF1421P Length=300 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Pag2472ORF12535P Length=290 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 111447879 Query= Pam744ORF26010P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Paq56ORF301P Length=275 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 33.5 0.007 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 33.5 bits (75), Expect = 0.007, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 31/77 (40%), Gaps = 3/77 (4%) Frame = +1 Query 180 LAMQPPKVDFAFFALPYNPYGKKADYNWAFPKRWFDMNNDESVLIGEEFWDLIGGEGTYE 239 LA P A+ YNPY + W +N D + + EFWD +G GTY Sbjct 414856 LASNPTI*ISTLIAISYNPYEPQPYNRWIMRGM---LNIDN*LKVASEFWDFLGRIGTYL 415026 Query 240 LFIDEINSLGKNYKERI 256 +D +G + I Sbjct 415027 ELLDCFERVGIELRPEI 415077 Lambda K H a alpha 0.320 0.140 0.428 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104053430 Query= PasAORF4395P Length=336 ***** No hits found ***** Lambda K H a alpha 0.318 0.132 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 135216128 Query= PbaD3IIP Length=212 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.430 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 72362441 Query= PbaD4IVP Length=83 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205250 Query= Pdi113806ORF32710P Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.133 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= Pdi12C09ORF3413P Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= Pdi8503IP Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= Pdi8503JORFCP Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= PdiR46ORF18790P Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= Pfa23572IIP Length=265 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= PfeHP2ORFAP Length=240 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 86095133 Query= PglCHR43ORF19420P Length=279 ***** No hits found ***** Lambda K H a alpha 0.317 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= Pha15H5ORF12745P Length=260 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96130580 Query= Phe2169ORFDP Length=226 ***** No hits found ***** Lambda K H a alpha 0.316 0.129 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 79228800 Query= PmeII Length=243 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 87679706 Query= Ppn32ORF25960P Length=193 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62855086 Query= Ppo681ORF4693P Length=268 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100356100 Query= Psc2052ORF10075P Length=372 ***** No hits found ***** Lambda K H a alpha 0.317 0.133 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 153702417 Query= Psp12121ORF31910P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psp12ORF1304P Length=283 ***** No hits found ***** Lambda K H a alpha 0.321 0.136 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Psp1446ORF6375P Length=350 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142610760 Query= Psp60ORFAP Length=299 ***** No hits found ***** Lambda K H a alpha 0.316 0.129 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116201580 Query= Psp860ORF5625P Length=350 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142610760 Query= Psp9ORF3313P Length=281 ***** No hits found ***** Lambda K H a alpha 0.324 0.138 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107222570 Query= PspAg1ORFAP Length=119 ***** No hits found ***** Lambda K H a alpha 0.314 0.128 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 26938200 Query= PspCCA1ORFEP Length=270 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= PspCT06ORF21175P Length=383 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= PspF39ORF241P Length=179 ***** No hits found ***** Lambda K H a alpha 0.318 0.135 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 55460370 Query= PspHYSORFBP Length=270 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= PsuGORF1606P Length=269 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Psy13929ORF16525P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psy1657ORFGP Length=269 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 100884290 Query= Psy17525ORF615P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psy3225ORFBP Length=276 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 104581620 Query= Psy3226ORFAP Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psy4219ORFBP Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psy6109ORF1042P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Psy76ORF28500P Length=193 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.412 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62855086 Query= PtoORF585P Length=205 ***** No hits found ***** Lambda K H a alpha 0.316 0.135 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68665090 Query= PveTEX2ORFEP Length=290 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 111447879 Query= PvuI Length=260 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96130580 Query= Pwa3304ORF395P Length=230 ***** No hits found ***** Lambda K H a alpha 0.312 0.129 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= R1.Lro951ORF14250P Length=147 ***** No hits found ***** Lambda K H a alpha 0.319 0.139 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 40142972 Query= R2.LblMEDORF15030P Length=300 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= R2.Lro951ORF14250P Length=147 ***** No hits found ***** Lambda K H a alpha 0.319 0.139 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 40142972 Query= RbeOORF2475P Length=202 ***** No hits found ***** Lambda K H a alpha 0.319 0.135 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 67080511 Query= RbeRORF883P Length=215 ***** No hits found ***** Lambda K H a alpha 0.321 0.137 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 73418688 Query= Rca13941ORF4183P Length=181 ***** No hits found ***** Lambda K H a alpha 0.323 0.138 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 56516758 Query= Rca13941ORF4397P Length=264 ***** No hits found ***** Lambda K H a alpha 0.322 0.137 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98243340 Query= Rmo1926IIP Length=279 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.421 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= Rmu17069ORF257P Length=305 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= RnaE4078ORF1786P Length=250 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 35.8 0.001 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 35.8 bits (81), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (6%) Frame = +1 Query 179 NTFFALYYNPNGKNRADYNHSFPMKMFDMHQDECVLIGEDYWNFIGGEGAYEDLLDIFSE 238 +T A+ YNP YN M ++ D + + ++W+F+G G Y +LLD F Sbjct 414883 STLIAISYNP--YEPQPYNRWIMRGMLNI--DN*LKVASEFWDFLGRIGTYLELLDCFER 415050 Query 239 VGEQTKKTLLNF 250 VG + + + N+ Sbjct 415051 VGIELRPEIDNY 415086 Lambda K H a alpha 0.316 0.134 0.381 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 91377043 Query= RshI Length=285 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 109335330 Query= Rsp13ORF19110P Length=285 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 109335330 Query= Rsp8ORF19105P Length=285 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 109335330 Query= RspAB24ORF17405P Length=261 ***** No hits found ***** Lambda K H a alpha 0.326 0.142 0.429 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= RspAB25ORF16930P Length=261 ***** No hits found ***** Lambda K H a alpha 0.326 0.142 0.429 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= RspLJ20ORF19135P Length=285 ***** No hits found ***** Lambda K H a alpha 0.324 0.140 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 109335330 Query= RspMGS30ORFOP Length=288 ***** No hits found ***** Lambda K H a alpha 0.317 0.133 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 110391501 Query= Rsu2351ORF623P Length=263 ***** No hits found ***** Lambda K H a alpha 0.323 0.141 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97715150 Query= Sag14747ORF11315P Length=349 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.380 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142082572 Query= SchDJ77ORFAP Length=316 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125180793 Query= Scy7437ORF843P Length=232 ***** No hits found ***** Lambda K H a alpha 0.317 0.134 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82397952 Query= Sen01O02ORF663P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen02O05ORF2753P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen03O05ORF767P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen04O05ORF844P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen05O02ORF828P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen06O05ORF663P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen0792ORF5905P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen08A05ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen09F08ORF4323P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen1028ORF23560P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen10708ORF20010P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen10A05ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen1175ORF11570P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen11A05ORF482P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen120523ORF22760P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen123ORF5765P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen1285ORF20090P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen12A06ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen132628ORF4572P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen13E05ORF3908P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen14E05ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen15023ORFAP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen1677ORF5680P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen1853IIP Length=198 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64967739 Query= Sen1854ORF3620P Length=198 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64967739 Query= Sen1855ORF3615P Length=198 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64967739 Query= Sen1900IVP Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen1923ORF6245P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen2169ORF20855P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen220ORFCP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24016ORFBP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24249ORF13220P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen24715ORF12675P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24759ORF9125P Length=305 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen24760ORF10430P Length=305 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen24778ORF4870P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24779ORF20050P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24780ORF17550P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen24781ORF18475P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen26289ORF18265P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen2916ORF2090P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen30878ORF2250P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen3307ORF20255P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen333712ORFCP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39514ORF8345P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39515ORF5505P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39516ORF7300P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39518ORF7155P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39520ORF8110P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39521ORF1770P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39522ORF6330P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39525ORF9095P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39527ORF7745P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39528ORF2125P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39529ORF1015P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39530ORF8120P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39531ORF14020P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39532ORF5230P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39536ORF8730P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39538ORF4610P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen39540ORF4770P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen40E08ORF480P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen41606ORF17710P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen41E09ORF3921P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen42E09ORF2613P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen43E09ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen44454ORF20885P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen44E09ORF2278P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen45E09ORF546P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen46E09ORF397P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen47E09ORF451P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen48E08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen49E09ORF222P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen50E08ORF345P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen51E09ORF404P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen52F08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen53F08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen5404ORFCP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen54O08ORF479P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen55391ORF2350P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen55U08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen5645ORF5770P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen567ORF6078P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen56O08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen57A08ORF2810P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen58E08ORF479P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen59F08ORF65P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen60O08ORF1068P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen61O08ORF178P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen63285ORF21235P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen664ORF3530P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen669ORF9P Length=111 ***** No hits found ***** Lambda K H a alpha 0.322 0.141 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 23240844 Query= Sen669ORFAP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen669ORFBP Length=176 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 54404085 Query= Sen6703ORF3842P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen68038ORF19060P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen68039ORF22470P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen6994ORFGP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen6994ORFLP Length=155 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 43840268 Query= Sen70644ORF21145P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen75713ORFBP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen76211ORF20330P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen76215ORF5740P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76332ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76333ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76334ORF14095P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76335ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76336ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76337ORF14080P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76338ORF14090P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76339ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76340ORF14085P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen76341ORF14080P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen78613ORFCP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sen7O05ORF639P Length=301 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= Sen80453ORF5390P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= Sen93ORF2644P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenC1727ORF5695P Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= SenC1765IVP Length=305 ***** No hits found ***** Lambda K H a alpha 0.321 0.140 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= SenC88ORF4014P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenK61ORFDP Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenL41ORF22340P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenNCTR144ORF1685P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenNCTR730ORF16500P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenR219ORF21405P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenS70ORF8168P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenS76ORF16519P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenSI01ORF18150P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenSI02ORF7325P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenSPE101ORF15285P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SenST02ORF5620P Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= SinCASDORFDP Length=261 ***** No hits found ***** Lambda K H a alpha 0.316 0.133 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= SinI Length=230 ***** No hits found ***** Lambda K H a alpha 0.315 0.131 0.383 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 81341568 Query= Sla442ORF15120P Length=261 ***** No hits found ***** Lambda K H a alpha 0.316 0.134 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 96658770 Query= Sma22ORF18410P Length=305 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 119370714 Query= SpiWPORF839P Length=239 ***** No hits found ***** Lambda K H a alpha 0.316 0.131 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 85566942 Query= SplZORFDP Length=270 ***** No hits found ***** Lambda K H a alpha 0.322 0.138 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 101412480 Query= SpoDORF1049P Length=341 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 137857068 Query= Ssa7778AORF200374P Length=258 ***** No hits found ***** Lambda K H a alpha 0.316 0.134 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 95602571 Query= Ssp2047ORF12480P Length=349 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 142082572 Query= Ssp22BORF23565P Length=266 ***** No hits found ***** Lambda K H a alpha 0.322 0.140 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 99299720 Query= Ssp3757ORF12980P Length=232 ***** No hits found ***** Lambda K H a alpha 0.318 0.134 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82397952 Query= Ssp42902ORFBP Length=243 ***** No hits found ***** Lambda K H a alpha 0.317 0.132 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 87679706 Query= Ssp6312ORF1107P Length=383 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 159512474 Query= Ssp7003ORF1875P Length=199 ***** No hits found ***** Lambda K H a alpha 0.317 0.137 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 65495932 Query= Ssp73109ORF1955AP Length=107 ***** No hits found ***** Lambda K H a alpha 0.313 0.129 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 21128040 Query= Ssp73109ORF1955BP Length=155 ***** No hits found ***** Lambda K H a alpha 0.318 0.131 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 43840268 Query= SspADCORF14070P Length=296 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114617013 Query= SspADCORF14370P Length=296 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 114617013 Query= SspADCORF9790P Length=265 ***** No hits found ***** Lambda K H a alpha 0.322 0.139 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= SspAg1ORF13340P Length=300 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= SspAg2ORF16865P Length=300 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= SspF21ORF2915P Length=265 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= SspG1IP Length=281 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107222570 Query= SspH115ORF14690P Length=301 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 117257958 Query= SspNIH1IIP Length=281 ***** No hits found ***** Lambda K H a alpha 0.324 0.138 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 107222570 Query= SspSCADCORF660P Length=273 ***** No hits found ***** Lambda K H a alpha 0.319 0.136 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 102997050 Query= SspYBL2ORF25460P Length=316 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125180793 Query= SspYL23ORFJP Length=316 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125180793 Query= SumRL3ORF190P Length=316 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125180793 Query= TarIpORFGP Length=211 ***** No hits found ***** Lambda K H a alpha 0.318 0.137 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71834248 Query= TasMCE3ORF1107P Length=369 ***** No hits found ***** Lambda K H a alpha 0.318 0.136 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 152117856 Query= TbaCH5ORF2167P Length=262 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 46.6 5e-07 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 46.6 bits (109), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%) Frame = +1 Query 187 KTYYAFPYNPYGEEKSNYKWSFTKMYFDLNSEVLIGSEFWDFIGGRGTYSELLKLFRKFG 246 T A YNPY + N +W M ++++ + + SEFWDF+G GTY ELL F + G Sbjct 414883 STLIAISYNPYEPQPYN-RWIMRGM-LNIDN*LKVASEFWDFLGRIGTYLELLDCFERVG 415056 Query 247 EKRGREITKRL 257 + EI L Sbjct 415057 IELRPEIDNYL 415089 Lambda K H a alpha 0.319 0.138 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97186960 Query= Tbo1301ORF243860P Length=197 ***** No hits found ***** Lambda K H a alpha 0.317 0.132 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 64439546 Query= Tca511288ORF22615P Length=94 Score E Sequences producing significant alignments: (Bits) Value NC_002689.2 Thermoplasma volcanium GSS1, complete sequence 32.0 0.002 > NC_002689.2 Thermoplasma volcanium GSS1, complete sequence Length=1584804 Score = 32.0 bits (71), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query 19 VKAYYAMPYNPYGSTKFDYKWSYGLNYMPFEEAVVIGNEFWNIVGGATAYEELLDIYLEV 78 + A+ YNPY ++ G+ + + + + +EFW+ +G Y ELLD + V Sbjct 414880 ISTLIAISYNPYEPQPYNRWIMRGM--LNIDN*LKVASEFWDFLGRIGTYLELLDCFERV 415053 Query 79 GRE 81 G E Sbjct 415054 GIE 415062 Lambda K H a alpha 0.324 0.142 0.452 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 15317887 Query= TdeMSP14ORFAP Length=274 ***** No hits found ***** Lambda K H a alpha 0.318 0.139 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 103525240 Query= TdiTDORF7710P Length=294 ***** No hits found ***** Lambda K H a alpha 0.313 0.131 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 113560635 Query= Teq35865ORF1066P Length=63 ***** No hits found ***** Lambda K H a alpha 0.326 0.139 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205750 Query= TeqORF69P Length=63 ***** No hits found ***** Lambda K H a alpha 0.324 0.135 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13205750 Query= ThaI Length=216 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.412 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 73946880 Query= TiJP2ORFIP Length=279 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.426 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 106166190 Query= Tma100ORF336P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Tma200ORF336P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= TmaA7AORFBP Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= TmaI Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= TmaMSB8ORF326P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= TnaRKUORF964P Length=206 ***** No hits found ***** Lambda K H a alpha 0.318 0.138 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 69193283 Query= TneDI Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Tpa21527ORF533P Length=242 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 87151515 Query= TpeRKUORF591P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Tsp2812ORF3085P Length=224 ***** No hits found ***** Lambda K H a alpha 0.318 0.139 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Tsp7601ORF3589P Length=229 ***** No hits found ***** Lambda K H a alpha 0.314 0.129 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 80813376 Query= TspC2ORF3140P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= TspRQ2ORF604P Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Tsu2489ORF695P Length=232 ***** No hits found ***** Lambda K H a alpha 0.315 0.133 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 82397952 Query= UbaEIORFAP Length=127 ***** No hits found ***** Lambda K H a alpha 0.315 0.130 0.351 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 30635542 Query= UbaMDORFJ2P Length=210 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71306055 Query= UbaMDORFU9P Length=210 ***** No hits found ***** Lambda K H a alpha 0.317 0.136 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 71306055 Query= UbaMSORFA11P Length=114 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.401 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 24297200 Query= UbaMSORFA9P Length=132 ***** No hits found ***** Lambda K H a alpha 0.321 0.139 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 32748276 Query= UbaMSORFI5P Length=89 ***** No hits found ***** Lambda K H a alpha 0.322 0.141 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13733330 Query= UbaMSORFZ1P Length=114 ***** No hits found ***** Lambda K H a alpha 0.322 0.140 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 24297200 Query= UbaMSORFZ22P Length=177 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 54403982 Query= UbaQ1ORF2418P Length=263 ***** No hits found ***** Lambda K H a alpha 0.323 0.141 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97715150 Query= UbaSSORFAP Length=109 ***** No hits found ***** Lambda K H a alpha 0.314 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 22184442 Query= Vsp09022ORF7P Length=249 ***** No hits found ***** Lambda K H a alpha 0.314 0.130 0.390 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 90848852 Query= VspWDL1ORF6P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.421 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xal3836ORFAP Length=338 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 136272504 Query= Xax6369ORFHP Length=300 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.423 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xax859ORF4221P Length=193 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62855086 Query= Xci1003IIP Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xci14003ORF11595P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xci81009ORF12750P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XciHD1ORF15540P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XciMSCTORF11225P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XciX18ORFCP Length=193 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62855086 Query= XciX20ORFDP Length=193 ***** No hits found ***** Lambda K H a alpha 0.319 0.138 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 62855086 Query= Xfa11399ORF2680P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Xfa12ORF2655P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Xfa24ORF2680P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Xfa3124ORF2415P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaAORFC340P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaCO33ORF9800P Length=309 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 121483470 Query= XfaDORF1828P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaG1ORF11000P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaHib4ORF2620P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaHib4ORF4965P Length=309 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 121483470 Query= XfaMORF1670P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.402 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaORF641P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.135 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaPr8ORF2645P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaSyVAORF2041P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaXf32ORF2530P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= XfaXf6cORF2780P Length=283 ***** No hits found ***** Lambda K H a alpha 0.320 0.136 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 108278950 Query= Xfu10535ORF38160P Length=224 ***** No hits found ***** Lambda K H a alpha 0.320 0.139 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= Xfu49ORF4581P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xma1005IIP Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XmaIII Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor11089ORF3265P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor142ORF18900P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor145ORF21465P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor1947ORF14145P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor1948ORF15660P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor1949ORF6765P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor1951ORF17130P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor1952ORF6550P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor2013ORF3375P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor211ORF20735P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor236ORF20365P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor2374ORF6855P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor282ORFAP Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor298ORF6615P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor3125ORF18650P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor364ORF19555P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor364ORF3175P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor404ORF19570P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor404ORF3170P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor421ORF19545P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor421ORF3175P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor513ORF19575P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor513ORF3175P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor524ORF2875P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor563ORF2840P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor602ORF2885P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor61ORF21665P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor61aORFAP Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor61bORF3115P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor71ORF2850P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor7319ORF6595P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7320ORF6595P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7321ORF6595P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7322ORF6580P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7323ORF6590P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7324ORF6610P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7325ORF6790P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7337ORF6775P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor7340ORF6605P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor79ORF6965P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor8172ORF6560P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Xor85ORF3235P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor86ORF21870P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= Xor99AXIIP Length=224 ***** No hits found ***** Lambda K H a alpha 0.319 0.137 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 78172416 Query= XorBA13ORF6570P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorDak16ORF6610P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorKI Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= XorLN18ORF16730P Length=263 ***** No hits found ***** Lambda K H a alpha 0.321 0.138 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 97715150 Query= XorM9ORF3075P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= XorMAI106ORF6975P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI129ORF6955P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI145ORF6955P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI68ORF6945P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI73ORF6955P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI95ORF6965P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorMAI99ORF6965P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorN37ORF3120P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= XorPXO61ORF3170P Length=265 ***** No hits found ***** Lambda K H a alpha 0.320 0.138 0.400 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 98771530 Query= XorT19ORF6600P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= XorUg11ORF6595P Length=300 ***** No hits found ***** Lambda K H a alpha 0.320 0.137 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 116729769 Query= Yen20ORF4180P Length=256 ***** No hits found ***** Lambda K H a alpha 0.321 0.135 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 94546189 Database: genome_.fasta Posted date: Apr 24, 2022 6:51 PM Number of letters in database: 1,584,804 Number of sequences in database: 1 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40