TBLASTN 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= dcd_ecoli descripsion (193 letters) Database: vc 344 sequences; 4,053,984 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value embl|AE004411|AE004411 Vibrio cholerae O1 biovar eltor str. N169... 25 3.7 embl|AE004289|AE004289 Vibrio cholerae O1 biovar eltor str. N169... 25 6.3 embl|AE004228|AE004228 Vibrio cholerae O1 biovar eltor str. N169... 25 6.3 embl|AE004191|AE004191 Vibrio cholerae O1 biovar eltor str. N169... 25 6.3 embl|AE004147|AE004147 Vibrio cholerae O1 biovar eltor str. N169... 25 6.3 >embl|AE004411|AE004411 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, section 68 of 93 of the complete chromosome. Length = 10574 Score = 25.4 bits (54), Expect = 3.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 99 LPADLVGWLDGRSSLARLGLMVHVTAHRIDPGWS 132 +P L W R+ +++ HR +PGWS Sbjct: 1627 IPGSLASWR*NRNHRQGRCIILRSQRHRSEPGWS 1728 >embl|AE004289|AE004289 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 197 of 251 of the complete chromosome. Length = 10943 Score = 24.6 bits (52), Expect = 6.3 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 154 LIGALSFEPLSGPAVRPYNRREDAKYRNQQGAVASRIDK 192 L+G+ + L G A +P+ R+ YRN++ SRID+ Sbjct: 2578 LLGSQANV*LMGWAFKPFCARKRLIYRNRRLLKQSRIDR 2694 >embl|AE004228|AE004228 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 136 of 251 of the complete chromosome. Length = 11656 Score = 24.6 bits (52), Expect = 6.3 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = +2 Query: 86 GELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAHR-----IDPGWSGCIVLEFY 140 G+LALAVT + +P+ ++D + G+M+ T + D G+ +L + Sbjct: 6269 GDLALAVTCLLLFIPSHFFSYID----IRLFGVMIPATLPQGVFALWDEGYIALALLVLF 6436 Query: 141 NSGKLPLAL 149 S PL L Sbjct: 6437 CSSIAPLVL 6463 >embl|AE004191|AE004191 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 99 of 251 of the complete chromosome. Length = 11434 Score = 24.6 bits (52), Expect = 6.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -1 Query: 105 GWLDGRSSLARLGLMVHVTAHRIDPGWS 132 GW RS+L LGLM + P WS Sbjct: 6862 GWPKTRSALLSLGLMASI*ISAALPKWS 6779 >embl|AE004147|AE004147 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 55 of 251 of the complete chromosome. Length = 10856 Score = 24.6 bits (52), Expect = 6.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 17 LSINPRPPVERINGATVDVRLGNKFR 42 + +N + PVERIN A + L + FR Sbjct: 1709 VQLNDKQPVERINVAVNPIVLASPFR 1632 Database: vc Posted date: Oct 1, 2006 7:54 PM Number of letters in database: 4,053,984 Number of sequences in database: 344 Lambda K H 0.320 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 910,725 Number of Sequences: 344 Number of extensions: 12519 Number of successful extensions: 54 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 31 Number of HSP's gapped (non-prelim): 28 length of query: 193 length of database: 1,351,328 effective HSP length: 81 effective length of query: 112 effective length of database: 1,323,464 effective search space: 148227968 effective search space used: 148227968 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)