RID: JH7WW2YN013 Job Title:Protein Sequence Program: TBLASTN Query: unnamed protein product ID: lcl|Query_1781687(amino acid) Length: 161 Database: refseq_genomes (4 databases) Sequences producing significant alignments: Scientific Common Max Total Query E Per. Acc. Description Name Name Taxid Score Score cover Value Ident Len Accession Stegodyphus dumicola isolate AA2019 ecotype Namibia, Etosha... Stegodyphus ... NA 202533 42.0 42.0 41% 0.017 33.82 18041 NW_023328870.1 Argiope bruennichi chromosome 9, qqArgBrue1.1 Argiope brue... NA 94029 41.2 41.2 25% 0.034 39.02 130975627 NC_079159.1 Alignments: >Stegodyphus dumicola isolate AA2019 ecotype Namibia, Etosha unplaced genomic scaffold, ASM1061486v1 SEQ_16184 Sequence ID: NW_023328870.1 Length: 18041 Range 1: 14590 to 14787 Score:42.0 bits(97), Expect:0.017, Method:Compositional matrix adjust., Identities:23/68(34%), Positives:36/68(52%), Gaps:3/68(4%) Query 7 ALKAIDWVAFGEIIPRNQKAIANSLKSWNETLT-SRLATLPENPPAIDWAYYRANVAKAG 65 +K +D F +N I + + L +RL + PE PPAID++ YRA + Sbjct 14590 CMKILDMFIFC--FQKNCFVIMKYIYGYTLILFFNRLMSYPEKPPAIDFSAYRARLPNRA 14763 Query 66 LVDDFEKK 73 +VD+FEK+ Sbjct 14764 MVDEFEKQ 14787 >Argiope bruennichi chromosome 9, qqArgBrue1.1 Sequence ID: NC_079159.1 Length: 130975627 Range 1: 29297314 to 29297436 Score:41.2 bits(95), Expect:0.034, Method:Compositional matrix adjust., Identities:16/41(39%), Positives:28/41(68%), Gaps:0/41(0%) Query 33 SWNETLTSRLATLPENPPAIDWAYYRANVAKAGLVDDFEKK 73 ++ + L RL + PE PP+ID++ YR+ + +VD+FEK+ Sbjct 29297436 TFLKNLYFRLMSYPEKPPSIDFSLYRSRLPNPAMVDEFEKQ 29297314