Учебный сайт Ксении Березиной

← Назад к семестру

Гомологичное моделирование комплекса белка с лигандом

Используя известную структуру лизоцима форели как образец, будем строить модель комплекса лизоцима двустворчатого моллюска LYS_MERLU с лигандом.

Скачали последовательность белка LYS_MERLU и структуру белка-образца 1lmp.pdb.

Импортируем модуль modeller.

In [1]:
import sys 
sys.path.append('/usr/lib/modeller9v7/modlib/')
sys.path.append('/usr/lib/modeller9v7/lib/x86_64-intel8/python2.5/')
import modeller 
import _modeller
import modeller.automodel
In [2]:
env=modeller.environ()
env.io.hetatm=True
                         MODELLER 9v7, 2009/06/12, r6923

     PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS


                     Copyright(c) 1989-2009 Andrej Sali
                            All Rights Reserved

                             Written by A. Sali
                               with help from
           B. Webb, M.S. Madhusudhan, M-Y. Shen, M.A. Marti-Renom,
                N. Eswar, F. Alber, M. Topf, B. Oliva, A. Fiser,
                    R. Sanchez, B. Yerkovich, A. Badretdinov,
                      F. Melo, J.P. Overington, E. Feyfant
                 University of California, San Francisco, USA
                    Rockefeller University, New York, USA
                      Harvard University, Cambridge, USA
                   Imperial Cancer Research Fund, London, UK
              Birkbeck College, University of London, London, UK


Kind, OS, HostName, Kernel, Processor: 4, Linux kodomo.fbb.msu.ru 3.8-2-amd64 x86_64
Date and time of compilation         : 2009/06/12 12:23:44
MODELLER executable type             : x86_64-intel8
Job starting time (YY/MM/DD HH:MM:SS): 2017/09/06 13:43:09

In [3]:
#создаем объект выравнивания
alignm=modeller.alignment(env)
In [4]:
alignm.append(file='P86383.fasta', align_codes='all',alignment_format='FASTA')
## создадим модель
mdl = modeller.model(env, file='1lmp.pdb', model_segment=('FIRST:'+'A', 'LAST:'+'A'))
## и добавим в выравнивание
alignm.append_model(mdl, atom_files='1lmp.pdb', align_codes='1lmp')
## есть смысл поправить идентификатор
alignm[0].code = 'MERLU'
read_pd_459W> Residue type  NAG not recognized. 'automodel' model building
              will treat this residue as a rigid body.
              To use real parameters, add the residue type to ${LIB}/restyp.lib,
              its topology to ${LIB}/top_*.lib, and suitable forcefield
              parameters to ${LIB}/par.lib.
read_pd_459W> Residue type  NDG not recognized. 'automodel' model building
              will treat this residue as a rigid body.
              To use real parameters, add the residue type to ${LIB}/restyp.lib,
              its topology to ${LIB}/top_*.lib, and suitable forcefield
              parameters to ${LIB}/par.lib.

В pdb-файле есть сахара NAG и NDG:
HETNAM NAG N-ACETYL-D-GLUCOSAMINE
HETNAM NDG 2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE

In [6]:
#Делаем выравнивание и сохраняем
alignm.salign()
alignm.write(file='all_in_one.ali', alignment_format='PIR')
SALIGN_____> adding the next group to the alignment; iteration    1

Получили файл с выравниванием all_in_one.ali. Теперь строим модель:

In [7]:
## Выбираем объект для моделирования 
s = alignm[0]
pdb = alignm[1]

print s.code, pdb.code

## Создаем объект automodel
a = modeller.automodel.automodel(env, alnfile='all_in_one.ali', knowns= pdb.code, sequence = s.code )

a.name='mod'+s.code
a.starting_model = 1
a.ending_model = 2
a.make()
MERLU 1lmp
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE
read_to_681_> topology.submodel read from topology file:        3

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    14   122
              atom names           : C     +N
              atom indices         :   924     0

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    14   122
              atom names           : C     CA    +N    O
              atom indices         :   924   918     0   925
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
patch_s_522_> Number of disulfides patched in MODEL:        1
transfe_404W> At least one template is aligned with model residue   122:
              but no coordinates could be transferred. This usually
              occurs when your input files do not use the official
              PDBv3 atom names. Please check your templates.
irestab_402W> ires, irestp:      130       69
irestab_402W> ires, irestp:      130       69
irestab_402W> ires, irestp:      130       69
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
0 atoms in HETATM residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
0 atoms in residues without defined topology
constrained to be rigid bodies
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:     9863     9030
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      122
Number of all, selected real atoms                :      926     926
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :     9030    9030
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     1920
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         717.8771





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :     947       0      0   0.005   0.005      6.0416       1.000
 2 Bond angle potential               :    1266       0      3   2.014   2.014      99.681       1.000
 3 Stereochemical cosine torsion poten:     591       0     31  48.649  48.649      204.79       1.000
 4 Stereochemical improper torsion pot:     381       0      0   1.034   1.034      8.6559       1.000
 5 Soft-sphere overlap restraints     :    1920       0      0   0.002   0.002      1.1142       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2204       0      0   0.326   0.326      65.794       1.000
10 Distance restraints 2 (N-O)        :    2337       0      9   0.434   0.434      134.98       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     121       0      2   4.271   4.271      26.032       1.000
14 Sidechain Chi_1 dihedral restraints:      97       0      3  79.915  79.915      28.480       1.000
15 Sidechain Chi_2 dihedral restraints:      65       0      1  82.538  82.538      29.478       1.000
16 Sidechain Chi_3 dihedral restraints:      33       0      0  78.898  78.898      23.994       1.000
17 Sidechain Chi_4 dihedral restraints:      17       0      0  73.542  73.542      9.7172       1.000
18 Disulfide distance restraints      :       1       0      0   0.004   0.004     0.32185E-02   1.000
19 Disulfide angle restraints         :       2       0      0   0.929   0.929     0.38121E-01   1.000
20 Disulfide dihedral angle restraints:       1       0      0  18.934  18.934     0.40722       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     752       0      0   0.357   0.357      8.8332       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     120      22     15  32.954  74.324      65.737       1.000
26 Distance restraints 4 (SDCH-SDCH)  :      95       0      0   0.717   0.717      4.1050       1.000
27 Distance restraints 5 (X-Y)        :       0       0      0   0.000   0.000      0.0000       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: MERLU.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   13185.1895



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   3190   1F   2A C   N      10   12  -64.11  -62.50    3.49    0.52 -134.00 -171.38   11.63
    1          2A   2A N   CA     12   13  -37.81  -40.90                  147.00
    2   3191   2A   3G C   N      15   17   70.01   78.70   75.18    2.50  -80.20  159.92    8.50
    2          3G   3G N   CA     17   18  119.23 -166.10                  174.10
    3   3192   3G   4G C   N      19   21  -86.26  -80.20   16.46    0.95   82.20 -134.24    7.54
    3          4G   4G N   CA     21   22  158.79  174.10                    8.50
    4   3203  14I  15C C   N      98  100  -87.98  -63.00   74.32    7.80  -63.00   74.32    7.80
    4         15C  15C N   CA    100  101   28.90  -41.10                  -41.10
    5   3204  15C  16K C   N     104  106   59.28   56.60   10.97    0.61  -62.90  140.20   24.49
    5         16K  16K N   CA    106  107   27.97   38.60                  -40.80
    6   3207  18E  19S C   N     130  132   51.23   56.90   23.58    1.08  -64.10  148.97   18.94
    6         19S  19S N   CA    132  133   59.29   36.40                  -35.00
    7   3219  30M  31G C   N     215  217  -63.73  -62.40    3.27    0.45   82.20  153.22   11.60
    7         31G  31G N   CA    217  218  -38.21  -41.20                    8.50
    8   3224  35C  36G C   N     245  247 -176.29   82.20  101.54    6.72  -62.40  123.28   19.65
    8         36G  36G N   CA    247  248    6.01    8.50                  -41.20
    9   3225  36G  37Y C   N     249  251   57.10   55.90    7.91    0.64  -63.50  150.91   28.59
    9         37Y  37Y N   CA    251  252   47.32   39.50                  -43.40
   10   3226  37Y  38F C   N     261  263   68.28   58.10   17.86    0.97  -63.20  145.59   26.05
   10         38F  38F N   CA    263  264   18.22   32.90                  -44.30
   11   3231  42E  43A C   N     307  309  -77.24  -62.50   15.04    3.00 -134.00  178.38   10.95
   11         43A  43A N   CA    309  310  -43.90  -40.90                  147.00
   12   3232  43A  44Y C   N     312  314   18.93  -98.40  117.35    4.57 -124.30  143.54   10.49
   12         44Y  44Y N   CA    314  315  125.90  128.40                  135.40
   13   3242  53S  54S C   N     392  394   89.00 -136.60  137.50    4.75  -64.10 -149.29   17.47
   13         54S  54S N   CA    394  395 -179.77  151.20                  -35.00
   14   3245  56K  57S C   N     421  423   55.98   56.90   12.98    0.75  -64.10  146.75   19.01
   14         57S  57S N   CA    423  424   49.35   36.40                  -35.00
   15   3252  63Y  64C C   N     467  469  -67.72  -63.00    6.15    1.08 -117.90 -179.05    7.75
   15         64C  64C N   CA    469  470  -45.04  -41.10                  141.10
   16   3254  65A  66S C   N     478  480 -100.21  -72.40   88.96    4.37  -64.10   95.21    9.46
   16         66S  66S N   CA    480  481 -123.10  152.40                  -35.00
   17   3256  67L  68C C   N     492  494  -79.06 -117.90   66.77    1.96  -63.00  128.89   14.70
   17         68C  68C N   CA    494  495   86.79  141.10                  -41.10
   18   3291 102K 103G C   N     770  772  -63.30  -62.40    1.15    0.22   82.20  153.99   11.72
   18        103G 103G N   CA    772  773  -41.92  -41.20                    8.50
   19   3294 105T 106I C   N     787  789 -130.92 -120.60   60.67    3.86  -63.40  132.60   20.17
   19        106I 106I N   CA    789  790   70.52  130.30                  -43.60
   20   3297 108Y 109W C   N     811  813   54.95   58.80    5.23    0.22  -63.00  142.94   25.13
   20        109W 109W N   CA    813  814   36.54   33.00                  -44.20
   21   3300 111R 112L C   N     844  846 -109.68 -108.50   91.84    4.98  -63.50   93.99   11.52
   21        112L 112L N   CA    846  847   40.67  132.50                  -41.20
   22   3306 117G 118C C   N     888  890   65.74   57.40   28.05    0.95 -117.90 -139.77    9.53
   22        118C 118C N   CA    890  891    9.21   36.00                  141.10


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0    9   11   48   72  100  104  144  147  159  128


<< end of ENERGY.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      122
Number of all, selected real atoms                :      926     926
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :     9030    9030
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     1925
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         627.7158





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :     947       0      0   0.005   0.005      6.1474       1.000
 2 Bond angle potential               :    1266       0      2   1.830   1.830      83.513       1.000
 3 Stereochemical cosine torsion poten:     591       0     31  49.769  49.769      212.96       1.000
 4 Stereochemical improper torsion pot:     381       0      0   0.997   0.997      8.3117       1.000
 5 Soft-sphere overlap restraints     :    1925       0      0   0.003   0.003      1.9446       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2204       0      0   0.290   0.290      52.825       1.000
10 Distance restraints 2 (N-O)        :    2337       0      1   0.384   0.384      95.890       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     121       0      1   4.050   4.050      23.406       1.000
14 Sidechain Chi_1 dihedral restraints:      97       0      0  80.233  80.233      23.559       1.000
15 Sidechain Chi_2 dihedral restraints:      65       0      0  93.638  93.638      29.210       1.000
16 Sidechain Chi_3 dihedral restraints:      33       0      0  62.048  62.048      17.993       1.000
17 Sidechain Chi_4 dihedral restraints:      17       0      0  98.999  98.999      12.381       1.000
18 Disulfide distance restraints      :       1       0      0   0.010   0.010     0.17969E-01   1.000
19 Disulfide angle restraints         :       2       0      0   3.001   3.001     0.39763       1.000
20 Disulfide dihedral angle restraints:       1       0      0  14.252  14.252     0.23918       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     752       0      0   0.319   0.319      8.6182       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     120      19     15  28.652  71.288      44.322       1.000
26 Distance restraints 4 (SDCH-SDCH)  :      95       0      0   0.847   0.847      5.9790       1.000
27 Distance restraints 5 (X-Y)        :       0       0      0   0.000   0.000      0.0000       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: MERLU.V99990002
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   12981.2520



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   3192   3G   4G C   N      19   21  -80.86  -80.20   13.67    0.57   82.20 -137.12    7.26
    1          4G   4G N   CA     21   22  160.45  174.10                    8.50
    2   3203  14I  15C C   N      98  100  -81.25  -63.00   62.25    6.61  -63.00   62.25    6.61
    2         15C  15C N   CA    100  101   18.42  -41.10                  -41.10
    3   3204  15C  16K C   N     104  106   61.13   56.60    8.03    0.43  -62.90  143.80   25.11
    3         16K  16K N   CA    106  107   31.97   38.60                  -40.80
    4   3207  18E  19S C   N     130  132   66.91   56.90   24.34    0.99  -64.10  139.95   18.72
    4         19S  19S N   CA    132  133   14.21   36.40                  -35.00
    5   3219  30M  31G C   N     215  217  -64.55  -62.40    2.73    0.40   82.20  154.41   11.70
    5         31G  31G N   CA    217  218  -39.51  -41.20                    8.50
    6   3225  36G  37Y C   N     249  251   65.45   55.90   10.13    0.94  -63.50  151.51   28.64
    6         37Y  37Y N   CA    251  252   36.14   39.50                  -43.40
    7   3226  37Y  38F C   N     261  263   61.38   58.10    3.72    0.36  -63.20  145.64   26.25
    7         38F  38F N   CA    263  264   31.14   32.90                  -44.30
    8   3242  53S  54S C   N     392  394   97.05 -136.60  132.04    4.35  -64.10 -149.47   18.33
    8         54S  54S N   CA    394  395 -170.48  151.20                  -35.00
    9   3245  56K  57S C   N     421  423   58.60   56.90   14.14    1.05  -64.10  149.52   19.39
    9         57S  57S N   CA    423  424   50.43   36.40                  -35.00
   10   3254  65A  66S C   N     478  480   84.92   56.90   29.99    2.84  -64.10  160.92   21.50
   10         66S  66S N   CA    480  481   25.71   36.40                  -35.00
   11   3257  68C  69V C   N     498  500   59.83   55.90    4.24    0.52 -125.40 -157.53   10.77
   11         69V  69V N   CA    500  501   41.08   39.50                  143.30
   12   3268  79W  80A C   N     602  604 -108.13  -62.50   98.05   14.69  -62.50   98.05   14.69
   12         80A  80A N   CA    604  605   45.89  -40.90                  -40.90
   13   3286  97P  98R C   N     731  733  -65.46  -72.10   51.56    4.11  -63.00  125.90   17.17
   13         98R  98R N   CA    733  734 -166.98  141.90                  -41.10
   14   3287  98R  99G C   N     742  744   88.49   82.20   46.52    1.94  -62.40  150.93   27.11
   14         99G  99G N   CA    744  745  -37.59    8.50                  -41.20
   15   3291 102K 103G C   N     770  772  -63.32  -62.40    1.19    0.22   82.20  154.03   11.72
   15        103G 103G N   CA    772  773  -41.96  -41.20                    8.50
   16   3295 106I 107G C   N     795  797  -73.50  -62.40   11.12    2.01   82.20  163.66   12.40
   16        107G 107G N   CA    797  798  -41.92  -41.20                    8.50
   17   3297 108Y 109W C   N     811  813   59.35   58.80    1.72    0.13  -63.00  145.55   25.65
   17        109W 109W N   CA    813  814   34.63   33.00                  -44.20
   18   3300 111R 112L C   N     844  846 -108.55 -108.50   88.60    4.79  -63.50   96.29   11.80
   18        112L 112L N   CA    846  847   43.90  132.50                  -41.20
   19   3304 115I 116S C   N     878  880 -114.88 -136.60   92.03    4.16  -64.10  109.28    7.03
   19        116S 116S N   CA    880  881   61.77  151.20                  -35.00


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0    3   12   44   76  101   90  110  138  148  146


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
MERLU.B99990001.pdb            717.87714
MERLU.B99990002.pdb            627.71582

Программа рассчитала две pdb-структуры (MERLU.B99990001.pdb и MERLU.B99990002.pdb). Выбираем структуру с меньшим значением MODELLER objective function (см. Model evaluation). Это MERLU.B99990002.pdb.

In [12]:
#можно посмотреть структуру прямо в notebook!
import nglview
import ipywidgets
w1 = nglview.show_structure_file('MERLU.B99990002.pdb')
w1
In [13]:
from IPython.display import Image
Image(filename='02.png')
Out[13]:

Оказалось, что в этой полученной структуре MERLU лиганда нет.

Надо переделать работу, добавив три остатка лиганда к последовательности MERLU.

Если посмотреть в файл с выравниванием all_in_one.ali, то можно увидеть, что в конце последовательности 1lmp стоят три точки, но их нет в MERLU. Видимо, это лиганды, они и правда находятся в конце pdb-файла 1lmp:
HET NAG A 130 14
HET NAG A 131 14
HET NDG A 132 15
Добавляем три точки к последовательности MERLU и проделываем все шаги заново.

In [16]:
## Получить список остаков
s = ''
for res in alignm[0].residues:
    s += res.code
s += '...'
print s
## Добавить в объект выравнивание последовательность из  строки
alignm.append_sequence(s)
FAGGIVSQRCLSCICKMESGCRNVGCKMDMGSLSCGYFQIKEAYWIDCGRPGSSWKSCAASSYCASLCVQNYMKRYAKWAGCPLRCEGFAREHNGGPRGCKKGSTIGYWNRLQKISGCHGVQ...
In [18]:
alignm.salign()
alignm.write(file='all_in_one1.ali', alignment_format='PIR')
SALIGN_____> adding the next group to the alignment; iteration    1

SALIGN_____> adding the next group to the alignment; iteration    2
In [19]:
## Выбираем объект для моделирования 
s_lig = alignm[2]
pdb = alignm[1]
s_lig.code = 'MERLU-lig'

print s_lig.code, pdb.code

## Создаем объект automodel
a = modeller.automodel.automodel(env, alnfile='all_in_one1.ali', knowns= pdb.code , sequence = s_lig.code )

a.name='mod'+s_lig.code
a.starting_model = 1
a.ending_model = 2
a.make()
MERLU-lig 1lmp
automodel__W> Topology and/or parameter libraries already in memory. These will
                be used instead of the automodel defaults. If this is not what you
                want, clear them before creating the automodel object with
                env.libs.topology.clear() and env.libs.parameters.clear()
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    14   122
              atom names           : C     +N
              atom indices         :   924     0

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    14   122
              atom names           : C     CA    +N    O
              atom indices         :   924   918     0   925
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
patch_s_522_> Number of disulfides patched in MODEL:        1
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
43 atoms in HETATM residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
43 atoms in residues without defined topology
constrained to be rigid bodies
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    11264    10431
read_pd_403W> Treating residue type  NAG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.
read_pd_403W> Treating residue type  NAG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.
read_pd_403W> Treating residue type  NDG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      125
Number of all, selected real atoms                :      969     969
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    10431   10431
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     2164
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         828.8471





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :     947       0      0   0.005   0.005      6.2059       1.000
 2 Bond angle potential               :    1266       0      1   1.915   1.915      91.789       1.000
 3 Stereochemical cosine torsion poten:     591       0     25  49.368  49.368      217.05       1.000
 4 Stereochemical improper torsion pot:     381       0      0   1.177   1.177      11.128       1.000
 5 Soft-sphere overlap restraints     :    2164       1      2   0.008   0.008      15.627       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2204       0      0   0.313   0.313      60.626       1.000
10 Distance restraints 2 (N-O)        :    2337       0      8   0.444   0.444      137.52       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     121       0      1   4.387   4.387      27.463       1.000
14 Sidechain Chi_1 dihedral restraints:      97       0      1  89.534  89.534      40.434       1.000
15 Sidechain Chi_2 dihedral restraints:      65       0      0  92.626  92.626      28.249       1.000
16 Sidechain Chi_3 dihedral restraints:      33       0      0  78.850  78.850      19.648       1.000
17 Sidechain Chi_4 dihedral restraints:      17       0      0 109.458 109.458      13.814       1.000
18 Disulfide distance restraints      :       1       0      0   0.013   0.013     0.28467E-01   1.000
19 Disulfide angle restraints         :       2       0      0   2.114   2.114     0.19735       1.000
20 Disulfide dihedral angle restraints:       1       0      0  15.386  15.386     0.27660       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     752       0      0   0.484   0.484      18.838       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     120      26     21  37.986  79.827      114.00       1.000
26 Distance restraints 4 (SDCH-SDCH)  :      95       0      0   1.018   1.018      8.0610       1.000
27 Distance restraints 5 (X-Y)        :    1401       0      0   0.039   0.039      17.903       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: MERLU-lig.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   15415.5391



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   3192   3G   4G C   N      19   21  -83.42  -80.20   14.38    0.73   82.20 -135.48    7.39
    1          4G   4G N   CA     21   22  160.09  174.10                    8.50
    2   3204  15C  16K C   N     104  106   78.09   56.60   25.14    2.06  -62.90  155.82   27.21
    2         16K  16K N   CA    106  107   25.55   38.60                  -40.80
    3   3207  18E  19S C   N     130  132   64.40   56.90   17.71    0.72  -64.10  139.92   18.67
    3         19S  19S N   CA    132  133   20.35   36.40                  -35.00
    4   3209  20G  21C C   N     140  142   59.01  -69.10  144.50   13.45 -117.90 -170.64    7.60
    4         21C  21C N   CA    142  143 -151.35  141.80                  141.10
    5   3210  21C  22R C   N     146  148  -78.64  -63.00   23.50    2.73   57.30  149.23   18.58
    5         22R  22R N   CA    148  149  -23.56  -41.10                   38.00
    6   3213  24V  25G C   N     172  174   24.00  -62.40   93.76   14.91  -62.40   93.76   14.91
    6         25G  25G N   CA    174  175  -77.63  -41.20                  -41.20
    7   3219  30M  31G C   N     215  217  -64.47  -62.40    2.17    0.36   82.20  154.65   11.74
    7         31G  31G N   CA    217  218  -40.52  -41.20                    8.50
    8   3224  35C  36G C   N     245  247 -170.90   82.20  107.09    6.94  -62.40  116.81   18.70
    8         36G  36G N   CA    247  248    2.08    8.50                  -41.20
    9   3225  36G  37Y C   N     249  251   62.61   55.90    7.16    0.65  -63.50  149.56   28.29
    9         37Y  37Y N   CA    251  252   37.01   39.50                  -43.40
   10   3226  37Y  38F C   N     261  263   60.94   58.10    5.11    0.27  -63.20  143.99   25.93
   10         38F  38F N   CA    263  264   28.65   32.90                  -44.30
   11   3229  40I  41K C   N     289  291  -91.50 -118.00   91.29    4.00  -62.90   96.86   11.35
   11         41K  41K N   CA    291  292   51.74  139.10                  -40.80
   12   3242  53S  54S C   N     392  394   85.92 -136.60  143.30    4.74  -64.10 -159.27   17.08
   12         54S  54S N   CA    394  395 -168.37  151.20                  -35.00
   13   3245  56K  57S C   N     421  423   56.74   56.90   16.35    1.03  -64.10  149.35   19.28
   13         57S  57S N   CA    423  424   52.75   36.40                  -35.00
   14   3254  65A  66S C   N     478  480   81.13   56.90   26.07    2.44  -64.10  157.82   21.07
   14         66S  66S N   CA    480  481   26.77   36.40                  -35.00
   15   3256  67L  68C C   N     492  494  -99.47 -117.90   47.87    1.57  -63.00  142.75   15.36
   15         68C  68C N   CA    494  495   96.92  141.10                  -41.10
   16   3264  75R  76Y C   N     562  564 -101.13  -98.40   80.87    8.58  -63.50   98.45   13.96
   16         76Y  76Y N   CA    564  565   47.57  128.40                  -43.40
   17   3268  79W  80A C   N     602  604 -108.97  -62.50   94.30   14.13  -62.50   94.30   14.13
   17         80A  80A N   CA    604  605   41.16  -40.90                  -40.90
   18   3282  93H  94N C   N     708  710  -60.72 -119.90   59.24    2.52  -63.20  179.24   22.28
   18         94N  94N N   CA    710  711  139.67  137.00                  -41.10
   19   3283  94N  95G C   N     716  718  121.97   82.20   58.78    1.76  -62.40  175.75   31.13
   19         95G  95G N   CA    718  719  -34.78    8.50                  -41.20
   20   3291 102K 103G C   N     770  772  -62.60  -62.40    2.32    0.36   82.20  153.86   11.74
   20        103G 103G N   CA    772  773  -43.52  -41.20                    8.50
   21   3294 105T 106I C   N     787  789 -125.23 -120.60    4.66    0.34  -63.40 -175.89   28.40
   21        106I 106I N   CA    789  790  129.82  130.30                  -43.60
   22   3297 108Y 109W C   N     811  813   62.66   58.80    6.85    0.20  -63.00  144.60   25.57
   22        109W 109W N   CA    813  814   27.34   33.00                  -44.20
   23   3299 110N 111R C   N     833  835  -68.69  -63.00    6.36    0.87 -125.20 -172.43    7.66
   23        111R 111R N   CA    835  836  -38.25  -41.10                  140.60
   24   3300 111R 112L C   N     844  846   22.51  -63.50  118.26   21.40  -63.50  118.26   21.40
   24        112L 112L N   CA    846  847   39.97  -41.20                  -41.20
   25   3307 118C 119H C   N     894  896 -138.20 -125.60   15.57    0.39  -63.20 -174.41   28.10
   25        119H 119H N   CA    896  897  147.93  138.80                  -42.30
   26   3308 119H 120G C   N     904  906   63.79   78.70   36.51    0.55   82.20  142.48    7.83
   26        120G 120G N   CA    906  907 -132.78 -166.10                    8.50


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0    7    9   68   76  122  123  126  140  158  158


<< end of ENERGY.
read_pd_403W> Treating residue type  NAG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.
read_pd_403W> Treating residue type  NAG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.
read_pd_403W> Treating residue type  NDG as a BLK (rigid body)
              even though topology information appears to be at least
              partially available. To treat this residue flexibly
              instead, remove the corresponding 'MODELLER BLK RESIDUE'
              REMARK from the input PDB file.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      125
Number of all, selected real atoms                :      969     969
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    10431   10431
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     2205
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         910.2463





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :     947       0      0   0.005   0.005      7.2082       1.000
 2 Bond angle potential               :    1266       2      5   3.028   3.028      137.76       1.000
 3 Stereochemical cosine torsion poten:     591       0     33  50.974  50.974      228.04       1.000
 4 Stereochemical improper torsion pot:     381       0      0   1.175   1.175      11.513       1.000
 5 Soft-sphere overlap restraints     :    2205       1      2   0.008   0.008      15.979       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2204       0      0   0.284   0.284      56.545       1.000
10 Distance restraints 2 (N-O)        :    2337       1     12   0.436   0.436      165.03       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     121       0      0   4.158   4.158      24.668       1.000
14 Sidechain Chi_1 dihedral restraints:      97       0      0  85.473  85.473      34.871       1.000
15 Sidechain Chi_2 dihedral restraints:      65       0      0  95.534  95.534      27.765       1.000
16 Sidechain Chi_3 dihedral restraints:      33       0      0  75.014  75.014      20.847       1.000
17 Sidechain Chi_4 dihedral restraints:      17       0      0  97.754  97.754      10.163       1.000
18 Disulfide distance restraints      :       1       0      0   0.002   0.002     0.10558E-02   1.000
19 Disulfide angle restraints         :       2       0      0   2.424   2.424     0.25959       1.000
20 Disulfide dihedral angle restraints:       1       0      0  24.870  24.870     0.66115       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     752       0      0   0.368   0.368      10.041       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     120      29     19  34.861  82.867      130.94       1.000
26 Distance restraints 4 (SDCH-SDCH)  :      95       0      0   0.925   0.925      7.3419       1.000
27 Distance restraints 5 (X-Y)        :    1401       0      0   0.042   0.042      20.606       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: MERLU-lig.V99990002
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   15660.5410



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6014  10C   6V N   O      66   39    5.36    2.86    2.50    4.51    2.86    2.50    4.51

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   3192   3G   4G C   N      19   21  -86.82  -80.20    8.73    0.63   82.20 -127.33    7.51
    1          4G   4G N   CA     21   22  168.40  174.10                    8.50
    2   3194   5I   6V C   N      31   33  -78.15 -125.40   52.88    2.75  -62.40  151.36   20.10
    2          6V   6V N   CA     33   34  167.06  143.30                  -42.40
    3   3195   6V   7S C   N      38   40   73.06   56.90   72.04    3.37  -64.10  137.16   17.63
    3          7S   7S N   CA     40   41  -33.80   36.40                  -35.00
    4   3204  15C  16K C   N     104  106   75.41   56.60   19.99    1.94  -62.90  156.22   27.29
    4         16K  16K N   CA    106  107   31.83   38.60                  -40.80
    5   3207  18E  19S C   N     130  132   63.51   56.90   17.09    0.70  -64.10  139.22   18.57
    5         19S  19S N   CA    132  133   20.64   36.40                  -35.00
    6   3214  25G  26C C   N     176  178  -56.15  -63.00    6.89    1.18 -117.90 -171.19    8.18
    6         26C  26C N   CA    178  179  -40.47  -41.10                  141.10
    7   3219  30M  31G C   N     215  217  -65.18  -62.40    4.45    0.61   82.20  154.46   11.67
    7         31G  31G N   CA    217  218  -37.72  -41.20                    8.50
    8   3221  32S  33L C   N     225  227  -71.39  -70.70   18.55    1.38  -63.50  158.85   22.52
    8         33L  33L N   CA    227  228  160.14  141.60                  -41.20
    9   3222  33L  34S C   N     233  235   76.23   56.90   77.09    3.49  -64.10  140.37   17.89
    9         34S  34S N   CA    235  236  -38.23   36.40                  -35.00
   10   3224  35C  36G C   N     245  247 -175.61   82.20  102.64    6.51  -62.40  120.10   19.48
   10         36G  36G N   CA    247  248   -1.11    8.50                  -41.20
   11   3225  36G  37Y C   N     249  251   62.18   55.90    6.43    0.65  -63.50  149.83   28.35
   11         37Y  37Y N   CA    251  252   38.16   39.50                  -43.40
   12   3226  37Y  38F C   N     261  263   62.08   58.10    6.45    0.37  -63.20  144.55   26.02
   12         38F  38F N   CA    263  264   27.82   32.90                  -44.30
   13   3242  53S  54S C   N     392  394   90.32 -136.60  137.13    4.65  -64.10 -151.09   17.59
   13         54S  54S N   CA    394  395 -175.71  151.20                  -35.00
   14   3245  56K  57S C   N     421  423   56.27   56.90   16.16    0.98  -64.10  148.85   19.21
   14         57S  57S N   CA    423  424   52.54   36.40                  -35.00
   15   3254  65A  66S C   N     478  480  152.10   56.90   98.04   10.17  -64.10  151.59   17.12
   15         66S  66S N   CA    480  481   12.96   36.40                  -35.00
   16   3257  68C  69V C   N     498  500   63.29   55.90    7.91    0.97 -125.40 -161.13   10.59
   16         69V  69V N   CA    500  501   42.29   39.50                  143.30
   17   3264  75R  76Y C   N     562  564 -101.55  -98.40   81.19    8.61  -63.50   98.33   13.93
   17         76Y  76Y N   CA    564  565   47.27  128.40                  -43.40
   18   3269  80A  81G C   N     607  609   18.05   78.70   90.33    1.86  -62.40   99.15   14.63
   18         81G  81G N   CA    609  610  -99.15 -166.10                  -41.20
   19   3282  93H  94N C   N     708  710  -60.87 -119.90   59.18    2.56  -63.20  177.67   22.09
   19         94N  94N N   CA    710  711  141.25  137.00                  -41.10
   20   3283  94N  95G C   N     716  718  118.03   82.20   55.13    1.60  -62.40  179.74   31.78
   20         95G  95G N   CA    718  719  -33.40    8.50                  -41.20
   21   3286  97P  98R C   N     731  733  -65.66  -72.10   16.41    1.38  -63.00  161.93   22.05
   21         98R  98R N   CA    733  734  157.00  141.90                  -41.10
   22   3287  98R  99G C   N     742  744  121.91   82.20   60.32    1.77  -62.40  175.74   31.22
   22         99G  99G N   CA    744  745  -36.90    8.50                  -41.20
   23   3291 102K 103G C   N     770  772  -64.90  -62.40    5.47    0.95   82.20  156.90   11.99
   23        103G 103G N   CA    772  773  -46.06  -41.20                    8.50
   24   3294 105T 106I C   N     787  789 -131.18 -120.60   70.14    4.42  -63.40  124.61   18.94
   24        106I 106I N   CA    789  790   60.96  130.30                  -43.60
   25   3297 108Y 109W C   N     811  813   75.47   58.80   30.13    0.85  -63.00  147.95   26.15
   25        109W 109W N   CA    813  814    7.90   33.00                  -44.20
   26   3300 111R 112L C   N     844  846 -109.98 -108.50   70.10    3.80  -63.50  113.57   13.96
   26        112L 112L N   CA    846  847   62.42  132.50                  -41.20
   27   3303 114K 115I C   N     870  872  -88.23  -63.40   76.47   11.81  -63.40   76.47   11.81
   27        115I 115I N   CA    872  873   28.72  -43.60                  -43.60
   28   3304 115I 116S C   N     878  880 -141.02  -64.10   83.67    9.01  -64.10   83.67    9.01
   28        116S 116S N   CA    880  881   -2.07  -35.00                  -35.00
   29   3306 117G 118C C   N     888  890   65.60   57.40   29.28    1.02 -117.90 -138.88    9.57
   29        118C 118C N   CA    890  891    7.90   36.00                  141.10


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0   15   12   62  105  124  123  128  156  156  164


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
MERLU-lig.B99990001.pdb        828.84711
MERLU-lig.B99990002.pdb        910.24634

Программа построила две структуры теперь уже с лигандом: MERLU-lig.B99990001.pdb и MERLU-lig.B99990002.pdb.
У первой значение MODELLER OBJECTIVE FUNCTION меньше, поэтому выбираем ее:

In [20]:
from IPython.display import Image
Image(filename='lig.png')
Out[20]:

← Назад к семестру