ID V00620; SV 1; linear; genomic DNA; STD; PRO; 926 BP. XX AC V00620; J01837; XX DT 03-NOV-1982 (Rel. 02, Created) DT 07-JUL-2002 (Rel. 72, Last updated, Version 18) XX DE E. coli left end of transposon TN7 inserted into glmS terminator XX KW glmS gene; glutamine amidotransferase; transposon; KW unidentified reading frame. XX OS Escherichia coli OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. XX RN [1] RP 1-926 RX DOI; 10.1038/297601a0. RX PUBMED; 6283361. RA Lichtenstein C., Brenner S.; RT "Unique insertion site of Tn7 in the E. coli chromosome"; RL Nature 297(5867):601-603(1982). XX RN [2] RP 353-926 RX PUBMED; 3010949. RA Gay N.J., Tybulewicz V.L.J., Walker J.E.; RT "Insertion of transposon Tn7 into the Escherichia coli glmS transcriptional RT terminator"; RL Biochem. J. 234(1):111-117(1986). XX FH Key Location/Qualifiers FH FT source 1..926 FT /organism="Escherichia coli" FT /mol_type="genomic DNA" FT /db_xref="taxon:562" FT CDS <1..364 FT /codon_start=2 FT /transl_table=11 FT /gene="glmS" FT /db_xref="GOA:P17169" FT /db_xref="PDB:1JXA" FT /db_xref="PDB:1MOQ" FT /db_xref="PDB:1MOR" FT /db_xref="PDB:1MOS" FT /db_xref="PDB:1XFF" FT /db_xref="PDB:1XFG" FT /db_xref="PDB:2BPJ" FT /db_xref="PDB:2BPL" FT /db_xref="UniProtKB/Swiss-Prot:P17169" FT /protein_id="CAA23894.1" FT /translation="ISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNI FT EEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKG FT TDVDQPRNLAKSVTVE" FT misc_signal 369..389 FT /note="transcription terminator fragment" FT repeat_region 390..926 FT /transposon="Tn7" FT /note="Tn7 left end" FT -35_signal 469..475 FT /note="Tn7" FT -10_signal 492..497 FT /note="Tn7" FT misc_feature 500 FT /note="put. transcription start site (Tn7)" FT misc_signal 516 FT /note="put. new transcription termination site, tm site FT (glmS)" FT CDS 524..>926 FT /transl_table=11 FT /gene="Tn7URF1" FT /product="putative protein" FT /note="related to other transposases" FT /db_xref="GOA:P13988" FT /db_xref="PDB:1F1Z" FT /db_xref="PDB:1T0F" FT /db_xref="UniProtKB/Swiss-Prot:P13988" FT /protein_id="CAA23895.1" FT /translation="MAKANSSFSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSH FT RIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVI FT RGVDQVMSTDFLVDCKDGPFEQFAIQVKPA" XX SQ Sequence 926 BP; 249 A; 194 C; 227 G; 256 T; 0 other; gatctcttac attcacgctg aagcctacgc tgctggcgaa ctgaaacacg gtccgctggc 60 gctaattgat gccgatatgc cggttattgt tgttgcaccg aacaacgaat tgctggaaaa 120 actgaaatcc aacattgaag aagttcgcgc gcgtggcggt cagttgtatg tcttcgccga 180 tcaggatgcg ggttttgtaa gtagcgataa catgcacatc atcgagatgc cgcatgtgga 240 agaggtgatt gcaccgatct tctacaccgt tccgctgcag ctgctggctt accatgtcgc 300 gctgatcaaa ggcaccgacg ttgaccagcc gcgtaacctg gcaaaatcgg ttacggttga 360 gtaataaatg gatgccctgc gtaagcgggt gtgggcggac aataaagtct taaactgaac 420 aaaatagatc taaactatga caataaagtc ttaaactaga cagaatagtt gtaaactgaa 480 atcagtccag ttatgctgtg aaaaagcata ctggactttt gttatggcta aagcaaactc 540 ttcattttct gaagtgcaaa ttgcccgtcg tattaaagag gggcgtggcc aagggcatgg 600 taaagactat attccatggc taacagtaca agaagttcct tcttcaggtc gttcccaccg 660 tatttattct cataagacgg gacgagtcca tcatttgcta tctgacttag agcttgctgt 720 ttttctcagt cttgagtggg agagcagcgt gctagatata cgcgagcagt tccccttatt 780 acctagtgat accaggcaga ttgcaataga tagtggtatt aagcatcctg ttattcgtgg 840 tgtagatcag gttatgtcta ctgatttttt agtggactgc aaagatggtc cttttgagca 900 gtttgctatt caagtcaaac ctgcag 926 //