TBLASTN 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P00811 (377 letters) Database: vc 344 sequences; 4,053,984 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value embl|AE004315|AE004315 Vibrio cholerae O1 biovar eltor str. N169... 27 2.5 embl|AE004247|AE004247 Vibrio cholerae O1 biovar eltor str. N169... 27 3.3 embl|AE004359|AE004359 Vibrio cholerae O1 biovar eltor str. N169... 26 5.6 embl|AE004299|AE004299 Vibrio cholerae O1 biovar eltor str. N169... 26 5.6 embl|AE004427|AE004427 Vibrio cholerae O1 biovar eltor str. N169... 25 9.6 embl|AE004268|AE004268 Vibrio cholerae O1 biovar eltor str. N169... 25 9.6 >embl|AE004315|AE004315 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 223 of 251 of the complete chromosome. Length = 12615 Score = 27.3 bits (59), Expect = 2.5 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -3 Query: 225 VHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQS--RYWQTGDMY 282 VHV +D + + I+ + + Q+ L P+ L + I L + YWQ G Y Sbjct: 11764 VHVGQLKVDLDGNSLLG-IQVVNQLAQAGLGPISAEAAQLVEQINLQEETIEYWQLGFGY 11588 Query: 283 QGLGWEM 289 +G W + Sbjct: 11587 RGEQWSL 11567 >embl|AE004247|AE004247 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 155 of 251 of the complete chromosome. Length = 11034 Score = 26.9 bits (58), Expect = 3.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 78 LGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNG 119 + + + GVLG + R K+S ++YW +T + WNG Sbjct: 2586 ISKIPHQWAGVLGTLIMQR*PSKISKRMSRYWRSVT-QNWNG 2464 >embl|AE004359|AE004359 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, section 16 of 93 of the complete chromosome. Length = 11095 Score = 26.2 bits (56), Expect = 5.6 Identities = 15/63 (23%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 279 GDMYQGL--GWEMLDWPVNPDSIINGSDNKIALAARPVKAITPPTPAVRASWVHKTGATG 336 G +YQ W+ ++P+ +I + RP++++ P P R+ H++ T Sbjct: 5967 GRLYQSQHNAWQ*DEFPLGKAVLIRWREAHH*QKRRPLRSLLPSGPFYRSIGNHESAKTA 6146 Query: 337 GFG 339 G+G Sbjct: 6147 GWG 6155 >embl|AE004299|AE004299 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 207 of 251 of the complete chromosome. Length = 15309 Score = 26.2 bits (56), Expect = 5.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 331 KTGATGGFGSYVAFIPEKELGIVM 354 +TG + G G ++AFI K GIV+ Sbjct: 5854 RTGISAGIGLFLAFIALKNAGIVV 5783 >embl|AE004427|AE004427 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, section 84 of 93 of the complete chromosome. Length = 13363 Score = 25.4 bits (54), Expect = 9.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 310 AARPVKAITPPTPAVRAS 327 AA P+ + PPTPAVR + Sbjct: 10760 AAEPIDSKLPPTPAVRVT 10707 >embl|AE004268|AE004268 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 176 of 251 of the complete chromosome. Length = 10401 Score = 25.4 bits (54), Expect = 9.6 Identities = 20/81 (24%), Positives = 34/81 (41%) Frame = +2 Query: 262 KTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINGSDNKIALAARPVKAITPPT 321 K L QG Q+ + + QGL ++L + ++ S+N+ + A + + PP Sbjct: 1859 KYLYQGFQILRKAV----EPRQGLPCDLLLARLRKSLVLLVSENRCRMNAHHERFVQPP* 2026 Query: 322 PAVRASWVHKTGATGGFGSYV 342 VR W G SY+ Sbjct: 2027 VRVRQKWATLHFFLGSS*SYI 2089 Database: vc Posted date: Dec 23, 2006 3:09 PM Number of letters in database: 4,053,984 Number of sequences in database: 344 Lambda K H 0.317 0.133 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,939,068 Number of Sequences: 344 Number of extensions: 28707 Number of successful extensions: 151 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 119 Number of HSP's gapped (non-prelim): 48 length of query: 377 length of database: 1,351,328 effective HSP length: 87 effective length of query: 290 effective length of database: 1,321,400 effective search space: 383206000 effective search space used: 383206000 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)