BLASTP 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= KPN2Jun2003_26 [2066 - 1479] (REVERSE SENSE) (196 letters) Database: ep 4855 sequences; 1,534,022 total letters Searching..........done Score E Sequences producing significant alignments: (bits) Value YFET_ECOLI P77245 Putative HTH-type transcriptional regulator yfeT. 55 3e-09 RPIR_ECOLI P0ACS7 HTH-type transcriptional regulator rpiR (Als o... 42 2e-05 KSF5_ECOLI Q47334 Polysialic acid capsule expression protein kpsF. 41 7e-05 KSF1_ECOLI P42502 Polysialic acid capsule expression protein kpsF. 41 7e-05 KDSD_ECOLI P45395 Arabinose 5-phosphate isomerase (EC 5.3.1.13). 41 7e-05 YFHH_ECOLI P37767 Putative HTH-type transcriptional regulator yfhH. 37 8e-04 GMHA_ECOLI P63224 Phosphoheptose isomerase (EC 5.3.1.-) (Sedohep... 37 8e-04 >YFET_ECOLI P77245 Putative HTH-type transcriptional regulator yfeT. Length = 285 Score = 55.5 bits (132), Expect = 3e-09 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 5/115 (4%) Query: 23 LHQAMSRIDGAALASLEQAIAEANAVFVFGAGRSLLMLKAFAMRLMHIGLKVHVVGDV-- 80 L Q + +D A L + + I++A + + G G S L+ + + +LM IG +V D Sbjct: 113 LEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHV 172 Query: 81 ---VTPALQKGDLLLLASASGETASLVNVAAKAKQLGGTVALLTIFPESTLGKLA 132 V+ AL+KGD+ + S SG +V A A++ G TV +T +S L +LA Sbjct: 173 QATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLA 227 Database: ep Posted date: Oct 3, 2006 10:20 PM Number of letters in database: 1,534,022 Number of sequences in database: 4855 Lambda K H 0.320 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 545,837 Number of Sequences: 4855 Number of extensions: 20672 Number of successful extensions: 76 Number of sequences better than 1.0e-03: 7 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 70 Number of HSP's gapped (non-prelim): 7 length of query: 196 length of database: 1,534,022 effective HSP length: 80 effective length of query: 116 effective length of database: 1,145,622 effective search space: 132892152 effective search space used: 132892152 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 84 (37.0 bits)