# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: CheW.hmm # target sequence database: CheW_ur.fasta # output directed to file: results_ur.txt # per-seq hits tabular output: results_ur.tbl # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CheW_muscle [M=65] Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-33 105.5 0.3 1.1e-32 103.8 0.2 1.9 2 A0ABY1C7H2|unreviewed|CheW-like domain-containing protein|taxID: 9e-33 104.1 0.1 2e-32 103.0 0.1 1.6 1 D9R360|unreviewed|CheW protein|taxID:610130 9.7e-33 104.0 0.3 2.3e-32 102.8 0.2 1.7 1 A0A084JJQ1|unreviewed|Chemotaxis protein CheW|taxID:29354 1.9e-32 103.1 0.2 3.5e-32 102.2 0.2 1.5 1 A0ABX1VYF3|unreviewed|CheW-like domain-containing protein|taxID: 2.9e-32 102.5 0.3 5.2e-32 101.6 0.3 1.4 1 A0A2S6HRX4|unreviewed|CheW-like protein|taxID:384636 5.9e-32 101.5 0.3 1.2e-31 100.5 0.3 1.5 1 A0ABY7AGL7|unreviewed|CheW-like protein|taxID:29375 7.5e-32 101.1 0.2 1.3e-31 100.4 0.2 1.4 1 A0ABU4GMS0|unreviewed|Chemotaxis protein CheW|taxID:318465 2.9e-31 99.2 0.2 5.8e-31 98.3 0.2 1.5 1 A0A419SSB1|unreviewed|Chemotaxis protein CheW|taxID:94868 1e-30 97.5 0.1 1.8e-30 96.7 0.1 1.4 1 A0A3E2N6L6|unreviewed|Uncharacterized protein|taxID:253257 2.6e-29 93.0 0.5 8.3e-29 91.4 0.1 2.0 2 R0A3E8|unreviewed|CheW-like domain-containing protein|taxID: 1.3e-26 84.3 0.3 9.3e-24 75.2 0.1 2.2 2 A0ABV7HM96|unreviewed|CheW-like domain-containing protein|taxID: 1.2e-25 81.2 0.0 3.6e-23 73.3 0.0 2.3 2 A0A1N7K5P9|unreviewed|CheW-like domain-containing protein|taxID: 1.4e-25 81.1 0.0 2.8e-25 80.1 0.0 1.5 1 A0AAX1SKC7|unreviewed|Chemotaxis protein CheW|taxID:358742 8.6e-25 78.5 0.0 1e-21 68.7 0.0 2.5 2 A0ABU4UEB5|unreviewed|Chemoreceptor zinc-binding protein|taxID:30451 2.1e-24 77.3 0.0 2.5e-21 67.5 0.0 2.5 2 A0ABR9D9V1|unreviewed|Chemoreceptor zinc-binding domain-containing p 4.2e-24 76.3 0.1 4.3e-21 66.7 0.0 2.3 2 A0ABR9D6R5|unreviewed|Chemoreceptor zinc-binding domain-containing p 4.3e-24 76.3 0.0 6.9e-24 75.6 0.0 1.3 1 A0ABS7ZLV9|unreviewed|Chemoreceptor zinc-binding domain-containing p 3.5e-23 73.4 0.4 8.3e-23 72.2 0.1 1.8 1 A0A1G9J6T7|unreviewed|CheW-like domain-containing protein|taxID: 6e-23 72.6 0.0 1.5e-22 71.4 0.0 1.7 1 A0A6P1ME77|unreviewed|CheW-like domain-containing protein|taxID: 2.2e-22 70.8 0.0 4.7e-22 69.8 0.0 1.6 1 A0A9X3ISW3|unreviewed|Chemoreceptor zinc-binding domain-containing p 4.6e-20 63.4 0.0 1.9e-16 51.8 0.0 2.7 2 O87715|reviewed|Chemotaxis protein CheW|taxID:190650 9.2e-20 62.4 0.0 1.4e-19 61.8 0.0 1.3 1 A0A1E5C0I0|unreviewed|Chemotaxis protein|taxID:1185651 2.3e-19 61.2 0.0 1.7e-16 51.9 0.0 2.4 2 Q60251|reviewed|Chemotaxis protein CheW|taxID:1063 1.6e-18 58.5 0.0 7.7e-17 53.0 0.0 2.2 2 Q52881|reviewed|Chemotaxis protein CheW|taxID:266834 2e-18 58.1 0.0 2.9e-18 57.6 0.0 1.3 1 A0A7I9VIJ3|unreviewed|Chemoreceptor zinc-binding domain-containing p 2.4e-18 57.9 0.0 2.6e-17 54.6 0.0 2.2 2 Q2KCI0|reviewed|Probable chemotaxis protein CheW|taxID:34 2.5e-17 54.6 0.0 6.7e-17 53.2 0.0 1.7 2 O25152|reviewed|Chemotaxis protein CheW|taxID:85962 5.7e-14 43.9 0.1 2.7e-12 38.5 0.0 2.1 2 Q56311|reviewed|Chemotaxis protein CheW|taxID:243274 8.6e-14 43.3 0.0 1.2e-12 39.6 0.0 2.1 2 P39802|reviewed|Chemotaxis protein CheW|taxID:224308 3.3e-13 41.4 0.1 1.6e-12 39.2 0.0 2.1 2 P0A964|reviewed|Chemotaxis protein CheW|taxID:83333 3.3e-13 41.4 0.1 1.6e-12 39.2 0.0 2.1 2 P0A965|reviewed|Chemotaxis protein CheW|taxID:199310 3.3e-13 41.4 0.1 1.6e-12 39.2 0.0 2.1 2 P0A966|reviewed|Chemotaxis protein CheW|taxID:83334 3.3e-13 41.4 0.1 1.6e-12 39.2 0.0 2.1 2 P0A967|reviewed|Chemotaxis protein CheW|taxID:623 5.3e-13 40.8 0.1 2.3e-12 38.7 0.0 2.0 2 P06110|reviewed|Chemotaxis protein CheW|taxID:99287 7e-13 40.4 0.0 1.4e-12 39.4 0.0 1.5 1 O83453|reviewed|Chemotaxis protein CheW|taxID:243276 8.3e-13 40.1 0.0 1.9e-12 39.0 0.0 1.6 1 P21821|reviewed|Chemotaxis protein CheW|taxID:1028307 8.4e-13 40.1 0.0 2.1e-12 38.8 0.0 1.7 1 P37599|reviewed|Chemotaxis protein CheV|taxID:224308 6.6e-10 30.8 0.2 2.1e-08 26.0 0.0 2.5 2 O25154|reviewed|Chemotaxis protein CheV3|taxID:85962 2.8e-08 25.6 0.0 4.5e-08 25.0 0.0 1.3 1 P43502|reviewed|Protein PilI|taxID:208964 4.6e-08 24.9 0.0 2.5e-07 22.6 0.0 2.0 2 P43498|reviewed|Protein FrzA|taxID:34 2.9e-07 22.4 0.0 8.6e-07 20.9 0.0 1.9 1 Q56310|reviewed|Chemotaxis protein CheA|taxID:243274 6.3e-06 18.1 0.0 1.6e-05 16.8 0.0 1.7 1 P29072|reviewed|Chemotaxis protein CheA|taxID:224308 1.8e-05 16.6 0.1 7.2e-05 14.7 0.0 2.0 2 O24864|reviewed|Chemotaxis protein CheV1|taxID:85962 3.2e-05 15.8 0.1 0.00018 13.5 0.0 2.2 2 O25337|reviewed|Chemotaxis protein CheV2|taxID:85962 3.9e-05 15.6 0.0 0.00012 14.0 0.0 1.9 1 O25153|reviewed|Sensor histidine kinase CheAY|taxID:859 0.00014 13.8 0.0 0.00037 12.4 0.0 1.8 1 P96123|reviewed|Chemotaxis protein CheA|taxID:243276 0.00023 13.1 0.2 0.0023 9.9 0.0 2.7 2 Q44737|reviewed|Chemotaxis protein CheA|taxID:224326 Domain annotation for each sequence (and alignments): >> A0ABY1C7H2|unreviewed|CheW-like domain-containing protein|taxID:1297793 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.8 0.2 9.2e-33 1.1e-32 1 64 [. 9 71 .. 9 72 .. 0.98 2 ? -1.7 0.0 8 9.6 18 36 .. 214 231 .. 213 234 .. 0.84 Alignments for each domain: == domain 1 score: 103.8 bits; conditional E-value: 9.2e-33 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y++Fki+g+ly+++sk++stIvqlp dy++ipa+panv+gmf+yr++vi++ldLr+++GlkS+s A0ABY1C7H2|unreviewed|CheW-like 9 YILFKIAGSLYCINSKYISTIVQLP-DYSTIPAAPANVTGMFKYRNEVIQMLDLRVTFGLKSIS 71 9************************.************************************97 PP == domain 2 score: -1.7 bits; conditional E-value: 8 CheW_muscle 18 vstIvqlpldytqipaspa 36 v +Iv+ + ++++i++ ++ A0ABY1C7H2|unreviewed|CheW-like 214 VDEIVSVE-ELETIAGRDQ 231 78999999.9999998775 PP >> D9R360|unreviewed|CheW protein|taxID:610130 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.0 0.1 1.7e-32 2e-32 1 64 [. 9 71 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 103.0 bits; conditional E-value: 1.7e-32 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y++Fki+g+ly+++sk++stIvqlp dy++ipa+panv+gmf+yr++v+++ldLr+++GlkS+s D9R360|unreviewed|CheW 9 YILFKIAGSLYCVNSKYISTIVQLP-DYSTIPAAPANVTGMFKYRDEVVQMLDLRVTFGLKSIS 71 9************************.************************************97 PP >> A0A084JJQ1|unreviewed|Chemotaxis protein CheW|taxID:29354 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.8 0.2 1.9e-32 2.3e-32 1 64 [. 9 71 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 102.8 bits; conditional E-value: 1.9e-32 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y++Fki+g+ly+++sk++stIvqlp dy+ ipa+panv+gmf+yr++vi++ldLr+++GlkS+s A0A084JJQ1|unreviewed|Chemotaxis 9 YILFKIAGSLYCINSKYISTIVQLP-DYSAIPAAPANVTGMFKYRNEVIQMLDLRVTFGLKSIS 71 9************************.************************************97 PP >> A0ABX1VYF3|unreviewed|CheW-like domain-containing protein|taxID:2719233 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.2 0.2 2.9e-32 3.5e-32 1 65 [] 9 72 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 102.2 bits; conditional E-value: 2.9e-32 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSese 65 y+iFki+g+ly+++sk++stI+qlp +y++ipa+panv+gmf+yr+qvi+++dLr+++Glk+++e A0ABX1VYF3|unreviewed|CheW-like 9 YIIFKIAGSLYCINSKYISTILQLP-EYSTIPAAPANVTGMFKYRNQVINMMDLRITFGLKPITE 72 9************************.************************************976 PP >> A0A2S6HRX4|unreviewed|CheW-like protein|taxID:384636 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.6 0.3 4.4e-32 5.2e-32 1 64 [. 9 71 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 101.6 bits; conditional E-value: 4.4e-32 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y+iFki+g+ly+++sk++stI+qlp +y++ipa+panv+gmf+yr+qvi+++dLr+++Glk+++ A0A2S6HRX4|unreviewed|CheW-like 9 YIIFKIAGSLYCINSKYISTILQLP-EYSTIPAAPANVTGMFKYRNQVINMMDLRITFGLKPIV 71 9************************.***********************************986 PP >> A0ABY7AGL7|unreviewed|CheW-like protein|taxID:29375 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.5 0.3 9.9e-32 1.2e-31 1 63 [. 9 70 .. 9 72 .. 0.99 Alignments for each domain: == domain 1 score: 100.5 bits; conditional E-value: 9.9e-32 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 y+iFk+ g+ly+++s++vstIvqlp +y++ipa+panv+gmf+yr+qvi++ldLr+++G+kS+ A0ABY7AGL7|unreviewed|CheW-like 9 YIIFKLSGSLYCIDSRYVSTIVQLP-EYNTIPAAPANVTGMFKYRDQVIQMLDLRITFGMKSI 70 9************************.************************************6 PP >> A0ABU4GMS0|unreviewed|Chemotaxis protein CheW|taxID:318465 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.4 0.2 1.1e-31 1.3e-31 1 65 [] 9 72 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 100.4 bits; conditional E-value: 1.1e-31 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSese 65 y+iFki+g+ly+++sk++stI+qlp +y++ipa+pan++gmf+yr++vi+++dLr+++Glk+++e A0ABU4GMS0|unreviewed|Chemotaxis 9 YIIFKIAGSLYCINSKYISTILQLP-EYSTIPAAPANITGMFKYRDKVINMMDLRITFGLKPITE 72 9************************.************************************976 PP >> A0A419SSB1|unreviewed|Chemotaxis protein CheW|taxID:94868 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.3 0.2 4.9e-31 5.8e-31 1 63 [. 9 70 .. 9 72 .. 0.99 Alignments for each domain: == domain 1 score: 98.3 bits; conditional E-value: 4.9e-31 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 y+iFk+ g+ly+++s++vstIvq p +y++ipa+panv+gmf+yr+qvi++ldLr+++G+kS+ A0A419SSB1|unreviewed|Chemotaxis 9 YIIFKLSGSLYCIDSRHVSTIVQQP-EYNTIPAAPANVTGMFKYRDQVIQMLDLRITFGMKSI 70 9************************.************************************6 PP >> A0A3E2N6L6|unreviewed|Uncharacterized protein|taxID:253257 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.7 0.1 1.5e-30 1.8e-30 1 64 [. 9 71 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 96.7 bits; conditional E-value: 1.5e-30 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y+iFki+g+ly+++sk++stI+qlp +y++ipa+panv+gmf++r++vi+++dLr+++Glk+ s A0A3E2N6L6|unreviewed|Uncharacterized 9 YIIFKIAGSLYCINSKYISTILQLP-EYSTIPAAPANVTGMFKHRDKVINMMDLRITFGLKPVS 71 9************************.***********************************975 PP >> R0A3E8|unreviewed|CheW-like domain-containing protein|taxID:997894 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.4 0.1 7e-29 8.3e-29 1 63 [. 9 70 .. 9 72 .. 0.98 2 ? -1.4 0.0 6.6 7.9 18 40 .. 215 236 .. 214 242 .. 0.82 Alignments for each domain: == domain 1 score: 91.4 bits; conditional E-value: 7e-29 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 y++Fk+ +++y++ s+++stIvqlp +y++ip+sp++v+gmf+yr+qvi++ldLr+++G+kS R0A3E8|unreviewed|CheW-like 9 YIVFKLVDTYYCVSSECISTIVQLP-QYDKIPESPETVTGMFRYRNQVIQMLDLRTTFGFKSL 70 9************************.************************************7 PP == domain 2 score: -1.4 bits; conditional E-value: 6.6 CheW_muscle 18 vstIvqlpldytqipaspanvrg 40 v +I + + ++t i ++ ++v g R0A3E8|unreviewed|CheW-like 215 VDEIISVE-NLTVIEQKENHVVG 236 67888889.99999999999877 PP >> A0ABV7HM96|unreviewed|CheW-like domain-containing protein|taxID:1834034 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.2 0.1 7.8e-24 9.3e-24 2 65 .] 15 78 .. 14 78 .. 0.98 2 ? 7.3 0.0 0.013 0.015 3 37 .. 205 237 .. 203 252 .. 0.77 Alignments for each domain: == domain 1 score: 75.2 bits; conditional E-value: 7.8e-24 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSese 65 l+F+++++++Alp++sv++I+++++++ +++++++++r+++d++gqvi+i+d++rl+G++S++e A0ABV7HM96|unreviewed|CheW-like 15 LTFRCNDRFFALPINSVNYIMSEQGNNVNLRSTDHQTRKAMDFNGQVIQIIDFSRLIGASSQVE 78 9************************************************************975 PP == domain 2 score: 7.3 bits; conditional E-value: 0.013 CheW_muscle 3 iFkiggklyAlpsksvstIvqlpldytqipaspan 37 ++ +++ +A+ ++ vs I++ + ++ + +s + A0ABV7HM96|unreviewed|CheW-like 205 VLEANDQMFAIELDEVSGILECS--TDEVVSSTED 237 667899**************998..5555555555 PP >> A0A1N7K5P9|unreviewed|CheW-like domain-containing protein|taxID:484498 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.3 0.0 3.1e-23 3.6e-23 1 65 [] 16 81 .. 16 81 .. 0.98 2 ? 5.8 0.0 0.037 0.045 2 36 .. 208 241 .. 207 248 .. 0.87 Alignments for each domain: == domain 1 score: 73.3 bits; conditional E-value: 3.1e-23 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGlkSese 65 yl+F++ + +yAlp++s+++I++l+ +d++++p++++ +r+mf+y+g++ip+++++rl+G +S+ e A0A1N7K5P9|unreviewed|CheW-like 16 YLTFHLPRAKYALPVDSIQYITTLDaIDPHDVPGGKSGIRRMFTYEGTQIPLFNFSRLIGSTSQLE 81 9**************************************************************975 PP == domain 2 score: 5.8 bits; conditional E-value: 0.037 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspa 36 +i++ +g++y + ++s+ I + + + +p ++ A0A1N7K5P9|unreviewed|CheW-like 208 VILRAAGRTYGIELDSIDQIIEFD-SRHWLPDEKQ 241 899******************999.8787777666 PP >> A0AAX1SKC7|unreviewed|Chemotaxis protein CheW|taxID:358742 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.1 0.0 2.3e-25 2.8e-25 1 64 [. 9 71 .. 9 72 .. 0.98 Alignments for each domain: == domain 1 score: 80.1 bits; conditional E-value: 2.3e-25 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 y++F+i+g+ly+l+s++ s+I ++p dy++ip++pa+++gmf++++++++++dLr+ LG++S+s A0AAX1SKC7|unreviewed|Chemotaxis 9 YVLFHINGSLYCLNSQYLSKIRPMP-DYEKIPKAPASIMGMFRQDDRIVTLMDLRTELGYRSMS 71 9************************.************************************86 PP >> A0ABU4UEB5|unreviewed|Chemoreceptor zinc-binding protein|taxID:3045149 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.7 0.0 8.6e-22 1e-21 1 63 [. 3 62 .. 3 63 .. 0.98 2 ? 7.4 0.0 0.011 0.014 4 57 .. 192 248 .. 189 253 .. 0.78 Alignments for each domain: == domain 1 score: 68.7 bits; conditional E-value: 8.6e-22 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 +l+F ig+k+++lp++sv++Iv+++ + +p+s++n++++++++g+v+p+++L++lL++kS+ A0ABU4UEB5|unreviewed|Chemoreceptor 3 LLLFLIGEKYFCLPLSSVKRIVPIS---PVYPYSGQNSDPFYGIDGEVFPYVSLWDLLDIKSK 62 599**********************...**********************************7 PP == domain 2 score: 7.4 bits; conditional E-value: 0.011 CheW_muscle 4 FkiggklyAlpsksvstIvqlp..ldytqipaspanvrgmfdyr.gqvipildLrrl 57 k+ ++ A+ ++ vs Iv+ + ++ a ++++ ++ ++ gq +pi++L+ l A0ABU4UEB5|unreviewed|Chemoreceptor 192 AKHDANYLAIGIDEVSDIVKVKasMRRDNPIARSEHFSEFVSFEnGQAVPIINLASL 248 578888999999999999998865555555566778888999963799******976 PP >> A0ABR9D9V1|unreviewed|Chemoreceptor zinc-binding domain-containing protein|taxID:1854564 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.5 0.0 2.1e-21 2.5e-21 1 63 [. 3 62 .. 3 63 .. 0.98 2 ? 7.4 0.0 0.011 0.014 4 57 .. 192 248 .. 189 253 .. 0.78 Alignments for each domain: == domain 1 score: 67.5 bits; conditional E-value: 2.1e-21 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 +l+F ig+k+++lp++sv++Iv+++ + +p+s+++++++++++g+v+p+++L++lL++kS+ A0ABR9D9V1|unreviewed|Chemoreceptor 3 LLLFLIGEKYFCLPLSSVKRIVPIS---PVYPYSGQTSDPFYGIDGEVFPYVSLWDLLDIKSK 62 599**********************...**********************************7 PP == domain 2 score: 7.4 bits; conditional E-value: 0.011 CheW_muscle 4 FkiggklyAlpsksvstIvqlp..ldytqipaspanvrgmfdyr.gqvipildLrrl 57 k+ ++ A+ ++ vs Iv+ + ++ a ++++ ++ ++ gq +pi++L+ l A0ABR9D9V1|unreviewed|Chemoreceptor 192 AKHDANYLAIGIDEVSDIVKVKasMRRDNPIARSEHFSEFVSFEnGQAVPIINLASL 248 578888999999999999998865555555566778888999963799******976 PP >> A0ABR9D6R5|unreviewed|Chemoreceptor zinc-binding domain-containing protein|taxID:1854563 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.7 0.0 3.6e-21 4.3e-21 1 63 [. 3 62 .. 3 63 .. 0.98 2 ? 7.5 0.0 0.011 0.013 5 57 .. 193 248 .. 189 249 .. 0.81 Alignments for each domain: == domain 1 score: 66.7 bits; conditional E-value: 3.6e-21 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 +l+F ig+k+++lp++svs+Iv++p + +++s++ ++++++++g+v+p+++L++lL++kS+ A0ABR9D6R5|unreviewed|Chemoreceptor 3 LLHFLIGEKNFCLPLSSVSRIVPIP---PAYAYSGQASDPYYGIDGNVFPYVSLWDLLDIKSK 62 599**********************...**********************************7 PP == domain 2 score: 7.5 bits; conditional E-value: 0.011 CheW_muscle 5 kiggklyAlpsksvstIvqlp..ldytqipaspanvrgmfdyr.gqvipildLrrl 57 k+ ++ A+ +++v Iv + + ++ as++++ ++ ++ gq +pi++L+ l A0ABR9D6R5|unreviewed|Chemoreceptor 193 KHDAQYLAIGIDAVIDIVDVSpaMRCQNPIASSQHISEFVSFDnGQSVPIINLAHL 248 67778889999999999987757777777789999999999974799******875 PP >> A0ABS7ZLV9|unreviewed|Chemoreceptor zinc-binding domain-containing protein|taxID:671053 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.6 0.0 5.8e-24 6.9e-24 1 64 [. 3 67 .. 3 68 .. 0.98 Alignments for each domain: == domain 1 score: 75.6 bits; conditional E-value: 5.8e-24 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 yl+F+++++++Alp+++v++I++++ l++t+++++++++++m+dy+gq + il+L+rlL+++Se+ A0ABS7ZLV9|unreviewed|Chemoreceptor 3 YLSFRHQQQHFALPIDCVRFIAAENaLTPTNVATGNSQTFDMVDYDGQACVILSLARLLNQPSER 67 9**************************************************************86 PP >> A0A1G9J6T7|unreviewed|CheW-like domain-containing protein|taxID:1121325 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.2 0.1 6.9e-23 8.3e-23 2 65 .] 32 95 .. 31 95 .. 0.98 Alignments for each domain: == domain 1 score: 72.2 bits; conditional E-value: 6.9e-23 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSese 65 +iF+++++lyA++s+ + t+++lp+d+t i++++a+++g++++r+++++i+++r+l+G+kS++e A0A1G9J6T7|unreviewed|CheW-like 32 VIFRVANNLYAIDSNVTVTLTELPNDITPIQKKQACELGIMKLRNEIVSIISMRNLFGCKSSNE 95 79***********************************************************976 PP >> A0A6P1ME77|unreviewed|CheW-like domain-containing protein|taxID:2697030 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.4 0.0 1.2e-22 1.5e-22 2 64 .. 18 80 .. 17 81 .. 0.97 Alignments for each domain: == domain 1 score: 71.4 bits; conditional E-value: 1.2e-22 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 li+k++++++A+++++v+ I+++++++tq+++++++vrg++d+rg v+p+l+Lr++LG+ S++ A0A6P1ME77|unreviewed|CheW-like 18 LIVKLREQNFAVNCQNVLGIFRADMETTQMAGYSSYVRGVIDFRGAVVPLLELRNVLGVISFE 80 89***********************************************************86 PP >> A0A9X3ISW3|unreviewed|Chemoreceptor zinc-binding domain-containing protein|taxID:2997323 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.8 0.0 3.9e-22 4.7e-22 1 63 [. 3 66 .. 3 68 .. 0.98 Alignments for each domain: == domain 1 score: 69.8 bits; conditional E-value: 3.9e-22 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 yl+F++gg++yA+p+++v++I++ + +++t+i+++++++r++++y+g+ + +++L++lLG ++e A0A9X3ISW3|unreviewed|Chemoreceptor 3 YLSFSHGGHHYAVPLEHVRYIAASTsVKTTRIAYGNNEERDTINYEGHSCLVFNLAELLGDSPE 66 9************************************************************997 PP >> O87715|reviewed|Chemotaxis protein CheW|taxID:190650 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.8 0.0 1.6e-16 1.9e-16 1 61 [. 15 74 .. 15 77 .. 0.97 2 ! 8.5 0.0 0.0054 0.0064 1 58 [. 84 147 .. 84 148 .. 0.74 Alignments for each domain: == domain 1 score: 51.8 bits; conditional E-value: 1.6e-16 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlk 61 +++F++g++ y++++ +v++I + + t++p+sp + rg++++rg v+pi+dL+ LG++ O87715|reviewed|Chemotaxis 15 LISFRVGEQEYCVDIMAVREIRGWS-PATTLPQSPGYMRGVINLRGAVLPIMDLACRLGMP 74 599**********************.*****************************999986 PP == domain 2 score: 8.5 bits; conditional E-value: 0.0054 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlp.ld...ytqip..aspanvrgmfdyrgqvipildLrrlL 58 ++++k g++++ l +++vs I++++ +++++ a ++ vrg++ ++g+ i+ ++L r+L O87715|reviewed|Chemotaxis 84 FIVVKAGDRTVGLLVDAVSDILSINdDMiqpTPDVAcdAVRSFVRGIISIEGRMISEISLDRIL 147 57888888888899999999998874331113333333568999****************9987 PP >> A0A1E5C0I0|unreviewed|Chemotaxis protein|taxID:1185651 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.8 0.0 1.2e-19 1.4e-19 1 64 [. 3 66 .. 3 67 .. 0.97 Alignments for each domain: == domain 1 score: 61.8 bits; conditional E-value: 1.2e-19 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 +++Fk+g+k++Al++ +++ + q+++++tq+p+++++++g++d++g+++pi+dL +L++ +++ A0A1E5C0I0|unreviewed|Chemotaxis 3 FINFKVGQKTVALKILDILLTEQYEENLTQLPNDRESFLGIKDFMGKPVPIFDLGLILNRVATK 66 79*********************************************************99876 PP >> Q60251|reviewed|Chemotaxis protein CheW|taxID:1063 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.9 0.0 1.4e-16 1.7e-16 2 62 .. 14 73 .. 13 75 .. 0.96 2 ? 6.8 0.0 0.018 0.021 6 54 .. 87 141 .. 82 146 .. 0.77 Alignments for each domain: == domain 1 score: 51.9 bits; conditional E-value: 1.4e-16 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkS 62 + F+ig + +++++++v++I + + ++t +p +p+++ g++++rg v+pi++L++ LGl S Q60251|reviewed|Chemotaxis 14 VAFRIGSQEFCIDIRAVREIRSWT-PTTILPHAPSYIIGVINLRGSVVPIINLAERLGLGS 73 78**********************.*********************************988 PP == domain 2 score: 6.8 bits; conditional E-value: 0.018 CheW_muscle 6 iggklyAlpsksvstIvqlp.ldytqipaspan.....vrgmfdyrgqvipildL 54 + g+ + l +++vs I++lp + +p+ ++ vrg+++++ + + +ldL Q60251|reviewed|Chemotaxis 87 VEGQVVGLLVDAVSDILTLPpSSVQPMPKIASEttlsfVRGVITLDQRMLRLLDL 141 6778888889999*****9999999999876662333368999999999999998 PP >> Q52881|reviewed|Chemotaxis protein CheW|taxID:266834 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.0 0.0 6.5e-17 7.7e-17 2 63 .. 16 76 .. 15 77 .. 0.97 2 ? 3.4 0.0 0.21 0.24 35 58 .. 124 147 .. 88 150 .. 0.73 Alignments for each domain: == domain 1 score: 53.0 bits; conditional E-value: 6.5e-17 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 + F++g++ +++++ +v++I + + t +p +pa+v+g++++rg v+pi+d++ LG+k++ Q52881|reviewed|Chemotaxis 16 IAFRVGDQEFCVNIMAVREIRGWT-PATPMPHAPAYVLGVINLRGAVLPIVDFSARLGMKAA 76 89**********************.**********************************986 PP == domain 2 score: 3.4 bits; conditional E-value: 0.21 CheW_muscle 35 panvrgmfdyrgqvipildLrrlL 58 ++ rg+ +++g+ i +++L ++ Q52881|reviewed|Chemotaxis 124 RSFARGVLAIEGRMICLVELDSVF 147 455699************998776 PP >> A0A7I9VIJ3|unreviewed|Chemoreceptor zinc-binding domain-containing protein|taxID:2590199 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.6 0.0 2.4e-18 2.9e-18 3 64 .. 20 80 .. 18 81 .. 0.96 Alignments for each domain: == domain 1 score: 57.6 bits; conditional E-value: 2.4e-18 CheW_muscle 3 iFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 i+ +g++l+Al++ +v++++ lp +++++p+s++++rg++++r+ ++p++dLr++LGl+S++ A0A7I9VIJ3|unreviewed|Chemoreceptor 20 ILGVGPHLVALDAGAVQEMFVLP-PIHRLPGSRPHQRGVAALRAGTLPAVDLRVCLGLPSAT 80 789********************.************************************86 PP >> Q2KCI0|reviewed|Probable chemotaxis protein CheW|taxID:347834 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.6 0.0 2.2e-17 2.6e-17 2 63 .. 16 76 .. 15 77 .. 0.97 2 ? 0.9 0.0 1.2 1.4 35 58 .. 124 147 .. 85 150 .. 0.67 Alignments for each domain: == domain 1 score: 54.6 bits; conditional E-value: 2.2e-17 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 + F+ig++ +++++ sv++I + + t +p spa+ +g++++rg v+pi+dL+ LG+k++ Q2KCI0|reviewed|Probable 16 IAFRIGDQEFCVNIMSVREIRGWT-PATAMPHSPAYMLGVINLRGAVLPIIDLAARLGMKPA 76 89**********************.***********************************95 PP == domain 2 score: 0.9 bits; conditional E-value: 1.2 CheW_muscle 35 panvrgmfdyrgqvipildLrrlL 58 ++ rg+ +++ + i +++L l+ Q2KCI0|reviewed|Probable 124 RQFARGILAIDKRMICLIELEALF 147 344578888888888888887776 PP >> O25152|reviewed|Chemotaxis protein CheW|taxID:85962 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.2 0.0 5.7e-17 6.7e-17 1 64 [. 30 92 .. 30 93 .. 0.95 2 ? -2.0 0.0 10 12 30 52 .. 133 155 .. 123 161 .. 0.70 Alignments for each domain: == domain 1 score: 53.2 bits; conditional E-value: 5.7e-17 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSes 64 ++ F ig+ yA+p+ ++++Iv+ yt++p++p++v+g+f++rg+v+p+++Lr +Glk+e+ O25152|reviewed|Chemotaxis 30 FIGFIIGDEEYAIPILNILEIVKPI-GYTRVPETPNYVLGVFNLRGNVFPLISLRLKFGLKAEK 92 57799*****************966.***********************************987 PP == domain 2 score: -2.0 bits; conditional E-value: 10 CheW_muscle 30 qipaspanvrgmfdyrgqvipil 52 ++ ++ + g+ +++++ ++il O25152|reviewed|Chemotaxis 133 TLSDNNNLTYGIGKQNDRLVTIL 155 55556666777888888888776 PP >> Q56311|reviewed|Chemotaxis protein CheW|taxID:243274 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.5 0.0 2.2e-12 2.7e-12 2 61 .. 14 72 .. 13 74 .. 0.97 2 ? 3.3 0.0 0.22 0.26 18 57 .. 101 141 .. 98 145 .. 0.81 Alignments for each domain: == domain 1 score: 38.5 bits; conditional E-value: 2.2e-12 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlk 61 l+F i ++ A +++++ + + + d+t +p+s++ v g++++rg++ip+++L+ +LG++ Q56311|reviewed|Chemotaxis 14 LSFEIDEQALAFDVDNIEMVIEKS-DITPVPKSRHFVEGVINLRGRIIPVVNLAKILGIS 72 89*********************9.*********************************85 PP == domain 2 score: 3.3 bits; conditional E-value: 0.22 CheW_muscle 18 vstIvqlpldytqipas.panvrgmfdyrgqvipildLrrl 57 v++I++ +ld+t++ + ++++ g ++ +g+ i +ld + Q56311|reviewed|Chemotaxis 101 VLRITENQLDLTNVSDKfGKKSKGLVKTDGRLIIYLDIDKI 141 7788888888888875548899999********99998665 PP >> P39802|reviewed|Chemotaxis protein CheW|taxID:224308 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.6 0.0 1e-12 1.2e-12 2 60 .. 12 69 .. 11 71 .. 0.97 2 ? 1.6 0.0 0.75 0.89 37 63 .. 122 148 .. 106 150 .. 0.82 Alignments for each domain: == domain 1 score: 39.6 bits; conditional E-value: 1e-12 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGl 60 ++F ++gk yA+ + v+ I + + ++t++p+ +++ g++++rg v p++dLr L+l P39802|reviewed|Chemotaxis 12 IVFMVNGKEYAISVTQVKSIEKWQ-KPTRVPGVEPYICGVINLRGVVTPVIDLRKRLNL 69 89**********************.******************************9997 PP == domain 2 score: 1.6 bits; conditional E-value: 0.75 CheW_muscle 37 nvrgmfdyrgqvipildLrrlLGlkSe 63 ++ +++++++ ++i+d +L+ S+ P39802|reviewed|Chemotaxis 122 SIEQIVKQENRLLNIIDANAVLDKESS 148 66789999********99999988776 PP >> P0A964|reviewed|Chemotaxis protein CheW|taxID:83333 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.0 1.3e-12 1.6e-12 1 58 [. 19 75 .. 19 78 .. 0.96 2 ? -0.6 0.0 3.7 4.5 2 7 .. 89 94 .. 80 121 .. 0.57 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 1.3e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 +l+F +g+ y +++ v++I ++ + t+i+++pa + g+ ++rg ++pi+dLr+ + P0A964|reviewed|Chemotaxis 19 FLVFTLGDEEYGIDILKVQEIRGYD-QVTRIANTPAFIKGVTNLRGVIVPIVDLRIKF 75 699**********************.*****************************866 PP == domain 2 score: -0.6 bits; conditional E-value: 3.7 CheW_muscle 2 liFkig 7 +++ +g P0A964|reviewed|Chemotaxis 89 IVLNLG 94 333344 PP >> P0A965|reviewed|Chemotaxis protein CheW|taxID:199310 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.0 1.3e-12 1.6e-12 1 58 [. 19 75 .. 19 78 .. 0.96 2 ? -0.6 0.0 3.7 4.5 2 7 .. 89 94 .. 80 121 .. 0.57 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 1.3e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 +l+F +g+ y +++ v++I ++ + t+i+++pa + g+ ++rg ++pi+dLr+ + P0A965|reviewed|Chemotaxis 19 FLVFTLGDEEYGIDILKVQEIRGYD-QVTRIANTPAFIKGVTNLRGVIVPIVDLRIKF 75 699**********************.*****************************866 PP == domain 2 score: -0.6 bits; conditional E-value: 3.7 CheW_muscle 2 liFkig 7 +++ +g P0A965|reviewed|Chemotaxis 89 IVLNLG 94 333344 PP >> P0A966|reviewed|Chemotaxis protein CheW|taxID:83334 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.0 1.3e-12 1.6e-12 1 58 [. 19 75 .. 19 78 .. 0.96 2 ? -0.6 0.0 3.7 4.5 2 7 .. 89 94 .. 80 121 .. 0.57 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 1.3e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 +l+F +g+ y +++ v++I ++ + t+i+++pa + g+ ++rg ++pi+dLr+ + P0A966|reviewed|Chemotaxis 19 FLVFTLGDEEYGIDILKVQEIRGYD-QVTRIANTPAFIKGVTNLRGVIVPIVDLRIKF 75 699**********************.*****************************866 PP == domain 2 score: -0.6 bits; conditional E-value: 3.7 CheW_muscle 2 liFkig 7 +++ +g P0A966|reviewed|Chemotaxis 89 IVLNLG 94 333344 PP >> P0A967|reviewed|Chemotaxis protein CheW|taxID:623 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.0 1.3e-12 1.6e-12 1 58 [. 19 75 .. 19 78 .. 0.96 2 ? -0.6 0.0 3.7 4.5 2 7 .. 89 94 .. 80 121 .. 0.57 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 1.3e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 +l+F +g+ y +++ v++I ++ + t+i+++pa + g+ ++rg ++pi+dLr+ + P0A967|reviewed|Chemotaxis 19 FLVFTLGDEEYGIDILKVQEIRGYD-QVTRIANTPAFIKGVTNLRGVIVPIVDLRIKF 75 699**********************.*****************************866 PP == domain 2 score: -0.6 bits; conditional E-value: 3.7 CheW_muscle 2 liFkig 7 +++ +g P0A967|reviewed|Chemotaxis 89 IVLNLG 94 333344 PP >> P06110|reviewed|Chemotaxis protein CheW|taxID:99287 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.7 0.0 2e-12 2.3e-12 1 56 [. 19 73 .. 19 75 .. 0.97 2 ? -0.9 0.0 4.4 5.2 2 11 .. 89 98 .. 80 121 .. 0.56 Alignments for each domain: == domain 1 score: 38.7 bits; conditional E-value: 2e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrr 56 +l+F +g+ y +++ v++I ++ + t+i+++pa + g+ ++rg ++pi+dLr+ P06110|reviewed|Chemotaxis 19 FLVFTLGNEEYGIDILKVQEIRGYD-QVTRIANTPAFIKGVTNLRGVIVPIVDLRV 73 699**********************.*****************************7 PP == domain 2 score: -0.9 bits; conditional E-value: 4.4 CheW_muscle 2 liFkiggkly 11 +++ +g++ + P06110|reviewed|Chemotaxis 89 IVLNLGQRVV 98 3444444444 PP >> O83453|reviewed|Chemotaxis protein CheW|taxID:243276 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.4 0.0 1.2e-12 1.4e-12 2 56 .. 24 77 .. 23 82 .. 0.95 Alignments for each domain: == domain 1 score: 39.4 bits; conditional E-value: 1.2e-12 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrr 56 ++F++g+ ly +++ v++Iv+ + d ip +pa+v g+f++r ++ipi++L O83453|reviewed|Chemotaxis 24 VTFQLGEELYGIDIMGVKEIVKVQ-DVRPIPCAPAYVEGIFNLRSEIIPIINLHK 77 89**********************.****************************76 PP >> P21821|reviewed|Chemotaxis protein CheW|taxID:1028307 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.0 0.0 1.6e-12 1.9e-12 1 58 [. 19 75 .. 19 79 .. 0.97 Alignments for each domain: == domain 1 score: 39.0 bits; conditional E-value: 1.6e-12 CheW_muscle 1 yliFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 +liF +g+ y +++ v++I ++ + t+i+++p + g+ ++rg ++pi+dLr+ + P21821|reviewed|Chemotaxis 19 FLIFTLGNEEYGIDILKVQEIRGYD-QVTRIANTPDFIKGVTNLRGVIVPIIDLRVKF 75 79***********************.*****************************865 PP >> P37599|reviewed|Chemotaxis protein CheV|taxID:224308 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.8 0.0 1.8e-12 2.1e-12 3 63 .. 21 80 .. 19 82 .. 0.95 Alignments for each domain: == domain 1 score: 38.8 bits; conditional E-value: 1.8e-12 CheW_muscle 3 iFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 F +g++ + +++ v++I q + t +p s ++v gm+++rg+++p+++L +G+ +e P37599|reviewed|Chemotaxis 21 KFGVGENAFGINVMKVREIIQPV-EVTSVPHSHQHVEGMIKLRGEILPVISLFSFFGVEPE 80 69******************977.*********************************9886 PP >> O25154|reviewed|Chemotaxis protein CheV3|taxID:85962 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.0 0.0 1.8e-08 2.1e-08 11 63 .. 34 85 .. 31 87 .. 0.95 2 ? 1.9 0.0 0.59 0.7 35 59 .. 135 160 .. 133 162 .. 0.82 Alignments for each domain: == domain 1 score: 26.0 bits; conditional E-value: 1.8e-08 CheW_muscle 11 yAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGlkSe 63 y +++ v++I ++p ++ +p+ ++ g+fd+r +ip++dL+ +G+ + O25154|reviewed|Chemotaxis 34 YGINVAKVQEIIPMP-TLFEYPTNLDYIIGVFDLRSIIIPLIDLAKWIGIIPD 85 89*************.*********************************9885 PP == domain 2 score: 1.9 bits; conditional E-value: 0.59 CheW_muscle 35 panvrgmfdyr.gqvipildLrrlLG 59 ++n++g+ +++ ++++ ildL +L+ O25154|reviewed|Chemotaxis 135 KENITGTTRIEnDKTLLILDLESILD 160 6789999999725899*****99997 PP >> P43502|reviewed|Protein PilI|taxID:208964 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.0 0.0 3.8e-08 4.5e-08 3 59 .. 39 94 .. 38 96 .. 0.95 Alignments for each domain: == domain 1 score: 25.0 bits; conditional E-value: 3.8e-08 CheW_muscle 3 iFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLG 59 F+ gg+++ p+ v +++ +p ytq+p+ + v g+++ rg+ +pi+dL LG P43502|reviewed|Protein 39 GFRMGGRFFVAPMGEVGEVLHEP-RYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLG 94 59*********************.****************************98888 PP >> P43498|reviewed|Protein FrzA|taxID:34 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.6 0.0 2.1e-07 2.5e-07 4 58 .. 20 73 .. 17 74 .. 0.93 2 ? -0.2 0.0 2.8 3.3 47 58 .. 139 150 .. 123 153 .. 0.76 Alignments for each domain: == domain 1 score: 22.6 bits; conditional E-value: 2.1e-07 CheW_muscle 4 FkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 F++g+ +ps++v++++++ +t +p +p+ ++g+ ++rg+v+p+ldL r L P43498|reviewed|Protein 20 FRVGDLRLGVPSENVLEVLRAG-LLTPLPRTPSFIMGVTGHRGEVLPVLDLLRFL 73 888888899*************.****************************8765 PP == domain 2 score: -0.2 bits; conditional E-value: 2.8 CheW_muscle 47 qvipildLrrlL 58 + i++l+++ lL P43498|reviewed|Protein 139 EAINLLNFSKLL 150 679999999998 PP >> Q56310|reviewed|Chemotaxis protein CheA|taxID:243274 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.9 0.0 7.2e-07 8.6e-07 2 60 .. 547 601 .. 546 606 .. 0.88 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 7.2e-07 CheW_muscle 2 liFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGl 60 l++k+++ yA+p+ ++ tI++++ +d++++ + r+++ +rg+vip+ L+++L + Q56310|reviewed|Chemotaxis 547 LLVKVNNLVYAIPIANIDTILSISkEDIQRV-----QDRDVIVIRGEVIPVYRLWEVLQI 601 789*********************6666666.....569*****************9976 PP >> P29072|reviewed|Chemotaxis protein CheA|taxID:224308 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.8 0.0 1.3e-05 1.6e-05 2 58 .. 546 598 .. 545 601 .. 0.84 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 1.3e-05 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlL 58 l+ k+ + ++A+p++s+ +++ ++ + + + r ++d+rg+++p++ L + + P29072|reviewed|Chemotaxis 546 LLIKLEEETFAIPISSIIETAVID-RKDI---LQTHDREVIDFRGHIVPVVYLKEEF 598 789*********************.3333...35677999**********9988766 PP >> O24864|reviewed|Chemotaxis protein CheV1|taxID:85962 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.7 0.0 6.1e-05 7.2e-05 2 64 .. 23 88 .. 22 89 .. 0.84 2 ? -1.1 0.0 5.1 6.1 43 56 .. 157 170 .. 146 172 .. 0.76 Alignments for each domain: == domain 1 score: 14.7 bits; conditional E-value: 6.1e-05 CheW_muscle 2 liFkiggk..lyAlpsksvstIvqlpldytqipaspan.vrgmfdyrgqvipildLrrlLGlkSes 64 l F++g + lyA+++ ++++v++ +++t i +++ v g + +r +ip++d+ + + S++ O24864|reviewed|Chemotaxis 23 LCFRLGKNkdLYAVNVFKIREVVKYHGNLTIISHENNSlVEGLIIIRELTIPLIDMKKWFYYDSQN 88 56666543229*********************987665489***************9999888875 PP == domain 2 score: -1.1 bits; conditional E-value: 5.1 CheW_muscle 43 dyrgqvipildLrr 56 ++g+ ++++d O24864|reviewed|Chemotaxis 157 YFDGRLVQVVDIEK 170 699*******9866 PP >> O25337|reviewed|Chemotaxis protein CheV2|taxID:85962 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.5 0.0 0.00015 0.00018 9 58 .. 31 81 .. 20 86 .. 0.88 2 ? -1.9 0.0 9.3 11 5 25 .. 108 128 .. 104 138 .. 0.72 Alignments for each domain: == domain 1 score: 13.5 bits; conditional E-value: 0.00015 CheW_muscle 9 klyAlpsksvstIvqlpldytqipaspanv.rgmfdyrgqvipildLrrlL 58 +ly ++ +++I ++++ t i +++ v +g+ rg+ ip++d r L O25337|reviewed|Chemotaxis 31 QLYGMNIFKIREIIHYDGEVTEILGGSDGVmLGFLSVRGESIPLVDVKRWL 81 7999*************999999988887736**************98877 PP == domain 2 score: -1.9 bits; conditional E-value: 9.3 CheW_muscle 5 kiggklyAlpsksvstIvqlp 25 + ++ Al++ + +I + O25337|reviewed|Chemotaxis 108 HFSNHSIALKVLKIERIIHKN 128 566778899999999998766 PP >> O25153|reviewed|Sensor histidine kinase CheAY|taxID:85962 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.0 0.0 0.0001 0.00012 2 60 .. 523 577 .. 522 582 .. 0.76 Alignments for each domain: == domain 1 score: 14.0 bits; conditional E-value: 0.0001 CheW_muscle 2 liFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGl 60 l++ +++ +yA+p++sv+++v+++ ++ ++ ++++ + ++r++v++++ L++++ + O25153|reviewed|Sensor 523 LLVGVQEEYYAIPLSSVLETVRISqDEIYTV--DGKS---VLRLRDEVLSLVRLSDIFKV 577 67899*******************4444444..4443...56789999999988888865 PP >> P96123|reviewed|Chemotaxis protein CheA|taxID:243276 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.4 0.0 0.00031 0.00037 2 61 .. 667 722 .. 667 726 .. 0.89 Alignments for each domain: == domain 1 score: 12.4 bits; conditional E-value: 0.00031 CheW_muscle 2 liFkiggklyAlpsksvstIvqlp.ldytqipaspanvrgmfdyrgqvipildLrrlLGlk 61 l+ ++g+ y +p+ sv + ++ +++++i ++ +f+ r++vi++l L rl+G++ P96123|reviewed|Chemotaxis 667 LLIRVGQEVYSIPIASVIESHRIKsEEINRIDNY-----EVFNVRNEVISLLRLDRLFGIS 722 57899************99999998888888876.....59******************97 PP >> Q44737|reviewed|Chemotaxis protein CheA|taxID:224326 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 9.9 0.0 0.0019 0.0023 2 60 .. 731 786 .. 731 788 .. 0.84 2 ? -1.7 0.0 7.8 9.3 45 60 .. 843 858 .. 832 859 .. 0.88 Alignments for each domain: == domain 1 score: 9.9 bits; conditional E-value: 0.0019 CheW_muscle 2 liFkiggklyAlpsksvstIvqlpldytqipaspanvrgmfdyrgqvipildLrrlLGl 60 l++k g +y +p+++v+++ +++ ++i +n ++++r++vi++l L l+++ Q44737|reviewed|Chemotaxis 731 LLVKSGSETYVIPLNNVLETHRIT--EHDIK-LLENYHEVYNLRDEVISVLRLDKLFNI 786 577889999**************9..44443.3466778******************98 PP == domain 2 score: -1.7 bits; conditional E-value: 7.8 CheW_muscle 45 rgqvipildLrrlLGl 60 +g+v+ i+d l++l Q44737|reviewed|Chemotaxis 843 NGKVVLIIDVFKLFDL 858 699******9999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (65 nodes) Target sequences: 56 (19772 residues searched) Passed MSV filter: 54 (0.964286); expected 1.1 (0.02) Passed bias filter: 54 (0.964286); expected 1.1 (0.02) Passed Vit filter: 52 (0.928571); expected 0.1 (0.001) Passed Fwd filter: 47 (0.839286); expected 0.0 (1e-05) Initial search space (Z): 56 [actual number of targets] Domain search space (domZ): 47 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 69.63 // [ok]