RID: 0ZPD353C013 Job Title:POLG_HCVH8 P27956 Genome polyprotein (Fragment) Program: BLASTP Query: POLG_HCVH8 P27956 Genome polyprotein (Fragment) OS=Hepatitis C virus (isolate HCT18) OX=11110 PE=3 SV=1 ID: lcl|Query_6123011(amino acid) Length: 75 Database: swissprot Non-redundant UniProtKB/SwissProt sequences Sequences producing significant alignments: Scientific Common Max Total Query E Per. Acc. Description Name Name Taxid Score Score cover Value Ident Len Accession RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11107 149 149 100% 1e-46 100.00 192 P27954.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11110 150 150 100% 1e-45 100.00 321 P27956.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11117 149 149 100% 3e-45 98.67 321 P27957.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356386 151 151 100% 2e-43 100.00 3011 Q913D4.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356410 151 151 100% 2e-43 100.00 3011 Q81754.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11104 151 151 100% 2e-43 100.00 3011 P26664.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 63746 151 151 100% 3e-43 100.00 3011 P27958.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 421877 151 151 100% 3e-43 100.00 3011 Q03463.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 420174 151 151 100% 3e-43 98.67 3010 O92972.2 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 333284 151 151 100% 3e-43 98.67 3010 Q9WMX2.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 31642 151 151 100% 3e-43 98.67 3010 Q00269.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11116 150 150 100% 3e-43 98.67 3010 P26662.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11111 147 147 100% 5e-43 97.33 513 P27959.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11105 150 150 100% 7e-43 98.67 3010 P26663.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 31645 149 149 100% 1e-42 97.33 3010 P29846.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 421879 148 148 100% 3e-42 96.00 3010 Q913V3.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 31644 145 145 100% 4e-42 94.67 520 Q01403.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 31643 145 145 100% 5e-42 94.67 523 Q01404.4 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 329389 145 145 100% 3e-41 97.33 829 Q5EG65.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11112 144 144 100% 5e-41 93.33 737 P27960.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356418 144 144 100% 5e-41 93.33 3008 O39929.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356390 144 144 100% 6e-41 93.33 3014 O91936.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356414 144 144 100% 8e-41 90.67 3033 Q9QAX1.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356413 144 144 100% 1e-40 90.67 3037 Q68749.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11114 143 143 100% 1e-40 92.00 737 P27961.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11115 143 143 100% 2e-40 89.33 3033 P26661.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 357355 142 142 100% 3e-40 90.67 3023 Q81487.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11113 142 142 100% 3e-40 90.67 3033 P26660.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356425 141 141 100% 9e-40 90.67 3016 O92531.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356391 141 141 100% 1e-39 90.67 3019 Q5I2N3.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356422 140 140 100% 1e-39 90.67 3013 O92530.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356416 139 139 100% 4e-39 89.33 3021 Q81495.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356412 139 139 100% 4e-39 86.67 3033 Q9DHD6.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356420 139 139 100% 5e-39 89.33 3018 O39927.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356423 138 138 100% 1e-38 89.33 3022 Q68798.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356411 137 137 100% 1e-38 89.33 3033 Q99IB8.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356415 137 137 100% 3e-38 86.67 3021 Q81258.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356421 136 136 100% 5e-38 86.67 3019 O92529.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356424 136 136 100% 5e-38 88.00 3015 O92532.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 11109 126 126 84% 3e-36 100.00 309 P27955.1 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356419 128 128 99% 3e-35 82.43 3014 O39928.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... Hepatitis C ... NA 356417 121 121 81% 1e-32 91.80 3019 Q68801.3 RecName: Full=Genome polyprotein; Contains: RecName: Full=Core... GB virus-B NA 2847087 43.5 43.5 89% 2e-05 41.18 2864 Q69422.1 Alignments: >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35 [Hepatitis C virus (isolate EC1)] Sequence ID: P27954.1 Length: 192 Range 1: 1 to 75 Score:149 bits(376), Expect:1e-46, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 61 FLLALLSCLTVPASA 75 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HCT18] Sequence ID: P27956.1 Length: 321 Range 1: 1 to 75 Score:150 bits(379), Expect:1e-45, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 61 FLLALLSCLTVPASA 75 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus (isolate TH)] Sequence ID: P27957.1 Length: 321 Range 1: 1 to 75 Score:149 bits(377), Expect:3e-45, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFS+ Sbjct 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSL 60 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 61 FLLALLSCLTVPASA 75 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate India)] Sequence ID: Q913D4.3 Length: 3011 Range 1: 117 to 191 Score:151 bits(382), Expect:2e-43, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate HC-G9)] Sequence ID: Q81754.3 Length: 3011 Range 1: 117 to 191 Score:151 bits(382), Expect:2e-43, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate 1)] Sequence ID: P26664.3 Length: 3011 Range 1: 117 to 191 Score:151 bits(382), Expect:2e-43, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate H77)] Sequence ID: P27958.3 Length: 3011 Range 1: 117 to 191 Score:151 bits(381), Expect:3e-43, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus isolate HC-J1] Sequence ID: Q03463.1 Length: 3011 Range 1: 117 to 191 Score:151 bits(381), Expect:3e-43, Method:Compositional matrix adjust., Identities:75/75(100%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus isolate HC-J4] Sequence ID: O92972.2 Length: 3010 Range 1: 117 to 191 Score:151 bits(381), Expect:3e-43, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate Con1)] Sequence ID: Q9WMX2.3 Length: 3010 Range 1: 117 to 191 Score:151 bits(381), Expect:3e-43, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate HC-JT)] Sequence ID: Q00269.3 Length: 3010 Range 1: 117 to 191 Score:151 bits(381), Expect:3e-43, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate Japanese)] Sequence ID: P26662.3 Length: 3010 Range 1: 117 to 191 Score:150 bits(380), Expect:3e-43, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:75/75(100%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HC-J2] Sequence ID: P27959.3 Length: 513 Range 1: 117 to 191 Score:147 bits(372), Expect:5e-43, Method:Compositional matrix adjust., Identities:73/75(97%), Positives:74/75(98%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLED VNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDSVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate BK)] Sequence ID: P26663.3 Length: 3010 Range 1: 117 to 191 Score:150 bits(378), Expect:7e-43, Method:Compositional matrix adjust., Identities:74/75(99%), Positives:74/75(98%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate Taiwan)] Sequence ID: P29846.3 Length: 3010 Range 1: 117 to 191 Score:149 bits(377), Expect:1e-42, Method:Compositional matrix adjust., Identities:73/75(97%), Positives:74/75(98%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGG ARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus isolate HCR6] Sequence ID: Q913V3.1 Length: 3010 Range 1: 117 to 191 Score:148 bits(374), Expect:3e-42, Method:Compositional matrix adjust., Identities:72/75(96%), Positives:74/75(98%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGG ARALAHGVRV+EDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVVEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT+PASA Sbjct 177 FLLALLSCLTIPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HCV-KF] Sequence ID: Q01403.3 Length: 520 Range 1: 117 to 191 Score:145 bits(367), Expect:4e-42, Method:Compositional matrix adjust., Identities:71/75(95%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGA+RALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGASRALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FL AL+SCLT PASA Sbjct 177 FLSALMSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HCV-476] Sequence ID: Q01404.4 Length: 523 Range 1: 117 to 191 Score:145 bits(366), Expect:5e-42, Method:Compositional matrix adjust., Identities:71/75(95%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGA+RALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGASRALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FL AL+SCLT PASA Sbjct 177 FLSALMSCLTAPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2 [Hepatitis C virus (isolate Glasgow)] Sequence ID: Q5EG65.3 Length: 829 Range 1: 117 to 191 Score:145 bits(366), Expect:3e-41, Method:Compositional matrix adjust., Identities:73/75(97%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGF DLMGYIPLVGAPL GAARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFVDLMGYIPLVGAPLRGAARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HC-J5] Sequence ID: P27960.3 Length: 737 Range 1: 117 to 191 Score:144 bits(363), Expect:5e-41, Method:Compositional matrix adjust., Identities:70/75(93%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RN+GKVIDTLTCGFADLMGYIP+VGAPLGG ARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNVGKVIDTLTCGFADLMGYIPVVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+TVP SA Sbjct 177 FLLALLSCITVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus ED43] Sequence ID: O39929.3 Length: 3008 Range 1: 117 to 191 Score:144 bits(364), Expect:5e-41, Method:Compositional matrix adjust., Identities:70/75(93%), Positives:72/75(96%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAP+G ARALAHGVR LEDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPVGSVARALAHGVRALEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus SA13] Sequence ID: O91936.3 Length: 3014 Range 1: 117 to 191 Score:144 bits(364), Expect:6e-41, Method:Compositional matrix adjust., Identities:70/75(93%), Positives:72/75(96%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVG P+GG ARALAHGVRVLEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGGPVGGVARALAHGVRVLEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 F+LALLSCLTVP SA Sbjct 177 FILALLSCLTVPTSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate VAT96)] Sequence ID: Q9QAX1.3 Length: 3033 Range 1: 117 to 191 Score:144 bits(363), Expect:8e-41, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAP+GG ARALAHGVRVLEDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC++VP SA Sbjct 177 FLLALLSCMSVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate BEBE1)] Sequence ID: Q68749.3 Length: 3037 Range 1: 117 to 191 Score:144 bits(362), Expect:1e-40, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAP+GG ARALAHGVRVLEDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC++VP SA Sbjct 177 FLLALLSCISVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HC-J7] Sequence ID: P27961.3 Length: 737 Range 1: 117 to 191 Score:143 bits(361), Expect:1e-40, Method:Compositional matrix adjust., Identities:69/75(92%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAP+GG ARALAHGVRVLEDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+TVP SA Sbjct 177 FLLALLSCVTVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus isolate HC-J8] Sequence ID: P26661.3 Length: 3033 Range 1: 117 to 191 Score:143 bits(360), Expect:2e-40, Method:Compositional matrix adjust., Identities:67/75(89%), Positives:73/75(97%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLG+VIDT+TCGFADLMGYIP+VGAP+GG ARALAHGVRVLEDG+NYATGNLPGCSFSI Sbjct 117 RNLGRVIDTITCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+TVP SA Sbjct 177 FLLALLSCVTVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate Tr Kj)] Sequence ID: Q81487.3 Length: 3023 Range 1: 117 to 191 Score:142 bits(358), Expect:3e-40, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPL+GAP+GG ARALAHGVR LEDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLIGAPVGGVARALAHGVRALEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLAL SCLT PAS+ Sbjct 177 FLLALFSCLTCPASS 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus isolate HC-J6] Sequence ID: P26660.3 Length: 3033 Range 1: 117 to 191 Score:142 bits(358), Expect:3e-40, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:72/75(96%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RN+GKVIDTLTCGFADLMGYIP+VGAPLGG ARALAHGVRVLEDGVN+ATGNLPGCSFSI Sbjct 117 RNVGKVIDTLTCGFADLMGYIPVVGAPLGGVARALAHGVRVLEDGVNFATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+T P SA Sbjct 177 FLLALLSCITTPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate VN405)] Sequence ID: O92531.3 Length: 3016 Range 1: 117 to 191 Score:141 bits(355), Expect:9e-40, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAPLGG A ALAHGVR +EDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPLGGVAAALAHGVRAIEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate 6a33)] Sequence ID: Q5I2N3.3 Length: 3019 Range 1: 117 to 191 Score:141 bits(355), Expect:1e-39, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAPLGG A ALAHGVR +EDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPLGGVAAALAHGVRAIEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate VN235)] Sequence ID: O92530.3 Length: 3013 Range 1: 117 to 191 Score:140 bits(354), Expect:1e-39, Method:Compositional matrix adjust., Identities:68/75(91%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIP+VGAPLGG A ALAHGVR +EDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPVVGAPLGGVAAALAHGVRAVEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate HCV-K3a/650)] Sequence ID: Q81495.3 Length: 3021 Range 1: 117 to 191 Score:139 bits(351), Expect:4e-39, Method:Compositional matrix adjust., Identities:67/75(89%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVR LEDG+N+ATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRALEDGINFATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLAL SCL PA++ Sbjct 177 FLLALFSCLIHPAAS 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate JPUT971017)] Sequence ID: Q9DHD6.3 Length: 3033 Range 1: 117 to 191 Score:139 bits(350), Expect:4e-39, Method:Compositional matrix adjust., Identities:65/75(87%), Positives:72/75(96%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLG+VIDT+TCGFADLMGYIP+VGAP+GG ARALAHGVRVLEDG+NYAT NLPGCSFSI Sbjct 117 RNLGRVIDTITCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATRNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+TVP S+ Sbjct 177 FLLALLSCVTVPVSS 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate EUHK2)] Sequence ID: O39927.3 Length: 3018 Range 1: 117 to 191 Score:139 bits(349), Expect:5e-39, Method:Compositional matrix adjust., Identities:67/75(89%), Positives:70/75(93%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLM YIP+VGAPLGG A ALAHGVR +EDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMWYIPVVGAPLGGVAAALAHGVRAIEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate JK046)] Sequence ID: Q68798.3 Length: 3022 Range 1: 117 to 191 Score:138 bits(347), Expect:1e-38, Method:Compositional matrix adjust., Identities:67/75(89%), Positives:70/75(93%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCG ADLMGYIP++G PLGG A ALAHGVR +EDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGLADLMGYIPVIGGPLGGVAAALAHGVRAVEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLTVPASA Sbjct 177 FLLALLSCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus JFH-1] Sequence ID: Q99IB8.3 Length: 3033 Range 1: 117 to 191 Score:137 bits(346), Expect:1e-38, Method:Compositional matrix adjust., Identities:67/75(89%), Positives:71/75(94%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RN+GKVIDTLTCGFADLMGYIP+VGAPL GAARA+AHGVRVLEDGVNYATGNLPG FSI Sbjct 117 RNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSC+TVP SA Sbjct 177 FLLALLSCITVPVSA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate NZL1)] Sequence ID: Q81258.3 Length: 3021 Range 1: 117 to 191 Score:137 bits(344), Expect:3e-38, Method:Compositional matrix adjust., Identities:65/75(87%), Positives:70/75(93%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAP+GG ARALAHGVR LEDG+N+ATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRALEDGINFATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLAL SCL PA++ Sbjct 177 FLLALFSCLIHPAAS 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate Th580)] Sequence ID: O92529.3 Length: 3019 Range 1: 117 to 191 Score:136 bits(342), Expect:5e-38, Method:Compositional matrix adjust., Identities:65/75(87%), Positives:69/75(92%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCG ADLMGYIP+VG PLGG A ALAHGVR +EDG+NYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGLADLMGYIPVVGGPLGGVAAALAHGVRAIEDGINYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 F+LALLSCLT PASA Sbjct 177 FILALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate VN004)] Sequence ID: O92532.3 Length: 3015 Range 1: 117 to 191 Score:136 bits(342), Expect:5e-38, Method:Compositional matrix adjust., Identities:66/75(88%), Positives:69/75(92%), Gaps:0/75(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCG ADLMGYIP++G PLGG A ALAHGVR +EDGVNYATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGLADLMGYIPVLGGPLGGVAAALAHGVRAIEDGVNYATGNLPGCSFSI 176 Query 61 FLLALLSCLTVPASA 75 FLLALLSCLT PASA Sbjct 177 FLLALLSCLTTPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70 [Hepatitis C virus HCT27] Sequence ID: P27955.1 Length: 309 Range 1: 1 to 63 Score:126 bits(316), Expect:3e-36, Method:Compositional matrix adjust., Identities:63/63(100%), Positives:63/63(100%), Gaps:0/63(0%) Query 13 GFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVP 72 GFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVP Sbjct 1 GFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVP 60 Query 73 ASA 75 ASA Sbjct 61 ASA 63 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate EUH1480)] Sequence ID: O39928.3 Length: 3014 Range 1: 118 to 191 Score:128 bits(322), Expect:3e-35, Method:Compositional matrix adjust., Identities:61/74(82%), Positives:67/74(90%), Gaps:0/74(0%) Query 2 NLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIF 61 NLG+VI TLTCGF LMGYIPLVG P+GG +RALAHGV+VLEDG+NYATGNLPGC FSIF Sbjct 118 NLGRVIHTLTCGFPHLMGYIPLVGGPVGGVSRALAHGVKVLEDGINYATGNLPGCPFSIF 177 Query 62 LLALLSCLTVPASA 75 +LALL CLTVPASA Sbjct 178 VLALLWCLTVPASA 191 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein precursor; AltName: Full=Capsid protein C; AltName: Full=p23; Contains: RecName: Full=Mature core protein; AltName: Full=p21; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp32; AltName: Full=gp35; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; AltName: Full=gp68; AltName: Full=gp70; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; Short=p23; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; AltName: Full=Viroporin p70; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; AltName: Full=p8; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; AltName: Full=p27; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; AltName: Full=p56/58; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B; AltName: Full=p68 [Hepatitis C virus (isolate JK049)] Sequence ID: Q68801.3 Length: 3019 Range 1: 117 to 177 Score:121 bits(303), Expect:1e-32, Method:Compositional matrix adjust., Identities:56/61(92%), Positives:59/61(96%), Gaps:0/61(0%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSI 60 RNLGKVIDTLTCGFADLMGYIPLVGAP+GG ARALAHGVR LEDG+N+ATGNLPGCSFSI Sbjct 117 RNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRALEDGINFATGNLPGCSFSI 176 Query 61 F 61 F Sbjct 177 F 177 >RecName: Full=Genome polyprotein; Contains: RecName: Full=Core protein; Contains: RecName: Full=Envelope glycoprotein E1; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=NS1; Contains: RecName: Full=p13; Contains: RecName: Full=p6; Contains: RecName: Full=Viroporin p7; Contains: RecName: Full=Protease NS2; AltName: Full=Non-structural protein 2; Short=NS2; Contains: RecName: Full=Serine protease/helicase NS3; AltName: Full=Hepacivirin; AltName: Full=NS3 helicase; AltName: Full=NS3 protease; AltName: Full=NS3P; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B [GB virus-B] Sequence ID: Q69422.1 Length: 2864 Range 1: 85 to 149 Score:43.5 bits(101), Expect:2e-05, Method:Compositional matrix adjust., Identities:28/68(41%), Positives:39/68(57%), Gaps:4/68(5%) Query 1 RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAA-RALAHGVRVLEDGVNYATGNLPGCSFS 59 RNLG ++D D+ + PLVG + GA R + VR+LEDGVN+ATG Sbjct 85 RNLGILLDYPLGWIGDVTTHTPLVGPLVAGAVVRPVCQIVRLLEDGVNWATGWF---GVH 141 Query 60 IFLLALLS 67 +F++ LLS Sbjct 142 LFVVCLLS 149