Brief description of Bhendi yellow vein mosaic virus-associated alphasatellite

Brief description of Bhendi yellow vein mosaic virus-associated alphasatellite

Host virus classification (alphasatellites are not organised into genera or higher taxa.)


Group: ssDNA

Family: Geminiviridae

Genus: Begomovirus

Bhendi yellow vein mosaic virus-associated alphasatellite

ALPHASATELLITE - is a single stranded satellite DNA that is dependent on a helper virus for transmission (in fact, alphasatellites are hyperparasites of other viruses). The genome is a single circular single strand DNA molecule. There are no separate virons because the viral genomes are encapsidated within the coat protein of the helper virus. [1].

HOST VIRUS ORIGIN AND SIGNS OF DISEASE: The first Bhendi yellow vein mosaic virus was found in okra plants in 1924 in India and Sri Lanka[2]. A Complex of monopartite begomovirus and a small satellite DNA components is causing the yellow vein mosaic disease, which is one of the major okra production limitation in India[3].

INSECT VECTOR: All Begomoviruses in the family Geminiviridae are transmitted by the whitefly Bemisia tabaci [4].

Table 1. Main features of Bhendi yellow vein mosaic virus-associated alphasatellite genome
FEATURE VALUE
Virus name Bhendi yellow vein mosaic virus-associated alphasatellite
Название вируса Желтый жилковый мозаичный вирус-альфасателлит окры
Number of full genome fragments 1
Genome size (bp) 1316
CDS 1
Number of mature peptides NS 
 
  

   BYVMVA protein sequence in .fasta format 
   

>YP_006666513.1 replication protein 
MAAIKSVFWCFTIFFTSSSFPELIPLFENSCVSYACWQEEESPTTRRRHLQGYLQCKGQR
TLKQVKSLFGDLNPHLEKQRARKTDEARDYCMKEETRVSGPYEFGNYVAGGSNKRKLEDL
LDNSDXEIEEPQKFRRAMAMKMTKASHQWALENPFPFELKEWQERLSADLNLNPDDRAIF
WVYGPTGGEGKSQFAKYLGLNKNWLYLPGGKVNDMMYMYCKKPQSNLVIDYPRCNKDFIN
YAFLEMVKNRTVYSYKYEPVGFIDPTCNVHVVVMANFLPDYERISEDRIKLIDLS

References


[1]. Alphasatellite page on Wikipedia.

[2]. A. Balamurugan, Bhendi yellow vein mosaic virus research, Madurai Agricultural College and Research Institute (TNAU)

[3]. J.Jose, R.Usha, Bhendi yellow vein mosaic disease in India is caused by association of a DNA Beta satellite with a begomovirus, Virology. 2003 Jan 20;305(2):310-7.

[4]. S. A. Chandran,R. M. Packialakshmi et al., First report of an alphasatellite associated with Okra enation leaf curl virus, Virus Genes. June 2013, Volume 46, Issue 3, pp 585–587.


Back to term 1 page 🚶
© Sophia Veselova, 2016.