************************************************************************ ********** REPORT OF PROTEIN ANALYSIS by the WHAT IF program ********** ************************************************************************ Date : 2013-07-21 This report was created by WHAT IF version 20130702-1016 This document is a WHAT_CHECK-report that holds the findings of the WHAT IF program during the analysis of a PDB-file. Each reported fact has an assigned severity, one of: error : Items marked as errors are considered severe problems requiring immediate attention. warning: Either less severe problems or uncommon structural features. These still need special attention. note : Statistical values, plots, or other verbose results of tests and analyses that have been performed. If alternate conformations are present, only the first is evaluated. Hydrogen atoms are only included if explicitly requested, and even then they are not used in all checks. The software functions less well for non-canonical amino acids and exotic ligands than for the 20 canonical residues and canonical nucleic acids. Some remarks regarding the output: Residues/atoms in tables are normally given in a few parts: A number. This is the internal sequence number of the residue used by WHAT IF. The first residues in the file get number 1, 2, etc. The residue type. Normally this is a three letter amino acid type. The sequence number, between brackets. This is the residue number as it was given in the input file. It can be followed by the insertion code. The chain identifier. A single character. If no chain identifier was given in the input file, this will be a minus sign or a blank. A model number. If no model number exists, like in most X-ray files, this will be a blank or occasionally a minus sign. In case an atom is part of the output, the atom will be listed using the PDB nomenclature for type and identifier. To indicate the normality of a score, the score may be expressed as a Z-value or Z-score. This is just the number of standard deviations that the score deviates from the expected value. A property of Z-values is that the root-mean-square of a group of Z-values (the RMS Z-value) is expected to be 1.0. Z-values above 4.0 and below $-4.0$ are very uncommon. If a Z-score is used in WHAT IF, the accompanying text will explain how the expected value and standard deviation were obtained. The names of nucleic acids are DGUA, DTHY, OCYT, OADE, etc. The first character is a D or O for DNA or RNA respectively. This circumvents ambiguities in the many old PDB files in which DNA and RNA were both called A, C, G, and T. ERROR. C1A ( C1A) does not belong in NAG ( 149) B 0 ERROR. C2A ( C2A) does not belong in NAG ( 149) B 0 ERROR. C3A ( C3A) does not belong in NAG ( 149) B 0 ERROR. C4A ( C4A) does not belong in NAG ( 149) B 0 ERROR. C5A ( C5A) does not belong in NAG ( 149) B 0 ERROR. C6A ( C6A) does not belong in NAG ( 149) B 0 ERROR. C7A ( C7A) does not belong in NAG ( 149) B 0 ERROR. C8A ( C8A) does not belong in NAG ( 149) B 0 ERROR. N2A ( N2A) does not belong in NAG ( 149) B 0 ERROR. O3A ( O3A) does not belong in NAG ( 149) B 0 ERROR. O4A ( O4A) does not belong in NAG ( 149) B 0 ERROR. O5A ( O5A) does not belong in NAG ( 149) B 0 ERROR. O6A ( O6A) does not belong in NAG ( 149) B 0 ERROR. O7A ( O7A) does not belong in NAG ( 149) B 0 ERROR. C1B ( C1B) does not belong in NAG ( 149) B 0 ERROR. C2B ( C2B) does not belong in NAG ( 149) B 0 ERROR. C3B ( C3B) does not belong in NAG ( 149) B 0 ERROR. C4B ( C4B) does not belong in NAG ( 149) B 0 ERROR. C5B ( C5B) does not belong in NAG ( 149) B 0 ERROR. C6B ( C6B) does not belong in NAG ( 149) B 0 ERROR. C7B ( C7B) does not belong in NAG ( 149) B 0 ERROR. C8B ( C8B) does not belong in NAG ( 149) B 0 ERROR. N2B ( N2B) does not belong in NAG ( 149) B 0 ERROR. O3B ( O3B) does not belong in NAG ( 149) B 0 ERROR. O4B ( O4B) does not belong in NAG ( 149) B 0 ERROR. O5B ( O5B) does not belong in NAG ( 149) B 0 ERROR. O6B ( O6B) does not belong in NAG ( 149) B 0 ERROR. O7B ( O7B) does not belong in NAG ( 149) B 0 ERROR. C1C ( C1C) does not belong in NAG ( 149) B 0 ERROR. C2C ( C2C) does not belong in NAG ( 149) B 0 ERROR. C3C ( C3C) does not belong in NAG ( 149) B 0 ERROR. C4C ( C4C) does not belong in NAG ( 149) B 0 ERROR. C5C ( C5C) does not belong in NAG ( 149) B 0 ERROR. C6C ( C6C) does not belong in NAG ( 149) B 0 ERROR. C7C ( C7C) does not belong in NAG ( 149) B 0 ERROR. C8C ( C8C) does not belong in NAG ( 149) B 0 ERROR. OC ( OC ) does not belong in NAG ( 149) B 0 ERROR. O3C ( O3C) does not belong in NAG ( 149) B 0 ERROR. O4C ( O4C) does not belong in NAG ( 149) B 0 ERROR. O6C ( O6C) does not belong in NAG ( 149) B 0 ERROR. O7C ( O7C) does not belong in NAG ( 149) B 0 ERROR. N2C ( N2C) does not belong in NAG ( 149) B 0 ERROR. OLC ( OLC) does not belong in NAG ( 149) B 0 ======================================================================== ==== Compound code /home/whatif/httpd/htdocs/servers/tmp//tmpLyEexh/====L1.fil ======================================================================== # 1 # Error: Missing unit cell information No SCALE matrix is given in the PDB file. # 2 # Error: Missing symmetry information Problem: No CRYST1 card is given in the PDB file. SYMMETRY will be unavailable for this molecule. # 3 # Warning: Chain identifier inconsistency WHAT CHECK believes that certain residue(s) have the wrong chain identifier. It has corrected these chain identifiers as indicated in the table. In this table the residues (ligands, drugs, lipids, ions, sugars, etc) that got their chain identifier corrected are listed with the new chain identifier that is used throughout this validation report. WHAT CHECK does not care about the chain identifiers of water molecules. 14 NAG ( 149-) A -B # 4 # Note: No strange inter-chain connections detected No covalent bonds have been detected between molecules with non-identical chain identifiers. # 5 # Note: No duplicate atom names in ligands All atom names in ligands (if any) seem adequately unique. # 6 # Note: In all cases the primary alternate atom was used WHAT CHECK saw no need to make any alternate atom corrections (which means they are all correct, or there are none). # 7 # Note: No residues detected inside ligands Either this structure does not contain ligands with amino acid groups inside it, or their naming is proper (enough). # 8 # Note: No attached groups interfere with hydrogen bond calculations It seems there are no sugars, lipids, etc., bound (or very close) to atoms that otherwise could form hydrogen bonds. # 9 # Note: No probable side chain atoms with zero occupancy detected. Either there are no side chain atoms with zero occupancy, or the side chain atoms with zero occupancy were not present in the input PDB file (in which case they are listed as missing atoms), or their positions are sufficiently improbable to warrant a zero occupancy. # 10 # Note: No probable backbone atoms with zero occupancy detected. Either there are no backbone atoms with zero occupancy, or the backbone atoms with zero occupancy were not present in the input PDB file (in which case they are listed as missing atoms), or their positions are sufficiently improbable to warrant a zero occupancy. # 11 # Note: All residues have a complete backbone. No residues have missing backbone atoms. # 12 # Note: No C-alpha only residues There are no residues that consist of only an alpha carbon atom. # 13 # Note: Non-canonical residues WHAT CHECK has not detected any non-canonical residue(s). # 14 # Note: Content of the PDB file as interpreted by WHAT CHECK Content of the PDB file as interpreted by WHAT CHECK. WHAT CHECK has read your PDB file, and stored it internally in what is called 'the soup'. The content of this soup is listed here. An extensive explanation of all frequently used WHAT CHECK output formats can be found at swift.cmbi.ru.nl. Look under output formats. A course on reading this 'Molecules' table is part of the WHAT CHECK website. 1 1 ( 1) 148 ( 148) A Protein checkset 2 149 ( 149) 149 ( 149) A Sugar checkset 3 150 ( 148) 150 ( 148) A V O2 <- 148 checkset # 15 # Note: Some notes regarding the PDB file contents The numbers and remarks listed below have no explicit validation purpose, they are merely meant for the crystallographer or NMR spectroscopists to perhaps pinpoint something unexpected. See the WHAT CHECK course [REF] for an explanation of terms like 'poor', 'missing', etcetera (in case those words pop up in the lines underneath this message). The total number of amino acids found is 148 of which 78 have poor or (essentially) missing atoms Number of (recognized) sugars: 1 of which one has poor or (essentially) missing atoms') # 16 # Note: Secondary structure This is the secondary structure according to DSSP. Only helix (H), overwound or 3/10-helix (3), strand (S), turn (T) and coil (blank) are shown [REF]. All DSSP related information can be found at swift.cmbi.ru.nl/gv/dssp/ This is not really a structure validation option, but a very scattered secondary structure (i.e. many strands of only a few residues length, many Ts inside helices, etc) tends to indicate a poor structure. A full explanation of the DSSP secondary structure determination program together with a series of examples can be found at the WHAT CHECK website [REF]. Secondary structure assignment 10 20 30 40 50 60 | | | | | | 1 - 60 MKAPLLLGLLLLSVTVQGKVFERCDLARTLKRLGLAGFKGVSLANWMCLAKWESDYNTKA ( 1)-( 60) HHHHHHHHHHHT TT TT HHHHHHHHHHHHTT TT 70 80 90 100 110 120 | | | | | | 61 - 120 TNYNPGSRSTDYGIFQINSRYWCNDGKTPRAVNSCHIPCSDLLKDDITQAVACAKRVVSD ( 61)-( 120)SSS TTTT SSSTTTTSSTTTT TT TT TT 33333TT HHHHHHHHHHHTT 130 140 | | 121 - 148 PNGIRAWVAWRAHCENQDVSQYVRNCGV ( 121)-( 148)TT3333 HHHHHHTTTT HHHHTTT # 17 # Note: No rounded coordinates detected No significant rounding of atom coordinates has been detected. # 18 # Note: No artificial side chains detected No artificial side-chain positions characterized by chi-1=0.0 or chi-1=180.0 have been detected. # 19 # Warning: Unexpected atoms encountered While reading the PDB file, at least one atom was encountered that was not expected in the residue. This might be caused by a naming convention problem. It can also mean that a residue was found protonated that normally is not (e.g. aspartic acid). The unexpected atoms have been discarded; in case protons were deleted that actually might be needed, they will later be put back by the hydrogen bond validation software. This normally is not a warning you should worry too much about. # 20 # Warning: Missing atoms The atoms listed in the table below are missing from the entry. If many atoms are missing, the other checks can become less sensitive. Be aware that it often happens that groups at the termini of DNA or RNA are really missing, so that the absence of these atoms normally is neither an error nor the result of poor electron density. Some of the atoms listed here might also be listed by other checks, most noticeably by the options in the previous section that list missing atoms in several categories. The plausible atoms with zero occupancy are not listed here, as they already got assigned a non-zero occupancy, and thus are no longer 'missing'. 14 NAG ( 149-) A - O4 14 NAG ( 149-) A - C4 14 NAG ( 149-) A - C1 14 NAG ( 149-) A - O5 14 NAG ( 149-) A - C5 14 NAG ( 149-) A - C6 14 NAG ( 149-) A - O6 14 NAG ( 149-) A - C3 14 NAG ( 149-) A - O3 14 NAG ( 149-) A - C2 14 NAG ( 149-) A - N2 14 NAG ( 149-) A - C7 14 NAG ( 149-) A - O7 14 NAG ( 149-) A - C8 # 21 # Warning: B-factors outside the range 0.0 - 100.0 In principle, B-factors can have a very wide range of values, but in practice, B-factors should not be zero while B-factors above 100.0 are a good indicator that the location of that atom is meaningless. Be aware that the cutoff at 100.0 is arbitrary. 'High' indicates that atoms with a B-factor > 100.0 were observed; 'Zero' indicates that atoms with a B-factor of zero were observed. MET ( 1-) A - High LYS ( 2-) A - High ALA ( 3-) A - High PRO ( 4-) A - High LEU ( 5-) A - High LEU ( 6-) A - High LEU ( 7-) A - High GLY ( 8-) A - High LEU ( 9-) A - High 1 LEU ( 10-) A - High 1 LEU ( 11-) A - High 1 LEU ( 12-) A - High 1 SER ( 13-) A - High 1 THR ( 15-) A - High 1 GLN ( 17-) A - High 1 GLY ( 18-) A - High 1 LYS ( 19-) A - High 2 GLU ( 22-) A - High 2 ARG ( 23-) A - High 2 LEU ( 26-) A - High 2 ARG ( 28-) A - High 3 LEU ( 30-) A - High 3 LYS ( 31-) A - High 3 LEU ( 33-) A - High 3 LYS ( 39-) A - High 4 VAL ( 41-) A - High 4 ASN ( 45-) A - High 4 MET ( 47-) A - High 4 LEU ( 49-) A - High 5 LYS ( 51-) A - High 5 SER ( 54-) A - High 5 TYR ( 56-) A - High 6 THR ( 61-) A - High 6 ASN ( 62-) A - High 6 TYR ( 63-) A - High 6 PRO ( 65-) A - High 6 GLY ( 66-) A - High 6 SER ( 67-) A - High 6 ARG ( 68-) A - High 6 SER ( 69-) A - High 7 ILE ( 74-) A - High 7 PHE ( 75-) A - High 7 SER ( 79-) A - High 8 ARG ( 80-) A - High 8 TYR ( 81-) A - High 8 TRP ( 82-) A - High 8 ASN ( 84-) A - High 8 ASP ( 85-) A - High 8 GLY ( 86-) A - High 8 LYS ( 87-) A - High 8 PRO ( 89-) A - High 9 ARG ( 90-) A - High 9 HIS ( 96-) A - High 9 ILE ( 97-) A - High 9 PRO ( 98-) A - High 10 LEU ( 102-) A - High 10 LEU ( 103-) A - High 10 LYS ( 104-) A - High 10 ASP ( 105-) A - High 10 ILE ( 107-) A - High 10 GLN ( 109-) A - High 11 LYS ( 115-) A - High 11 ARG ( 116-) A - High 11 SER ( 119-) A - High 12 ASP ( 120-) A - High 12 ILE ( 124-) A - High 12 ARG ( 125-) A - High 12 VAL ( 128-) A - High 13 ARG ( 131-) A - High 13 HIS ( 133-) A - High 13 CYS ( 134-) A - High 13 GLU ( 135-) A - High 13 ASN ( 136-) A - High 13 GLN ( 137-) A - High 13 ASP ( 138-) A - High 13 VAL ( 139-) A - High 14 ARG ( 144-) A - High 14 VAL ( 148-) A - High # 22 # Note: No C-terminal nitrogen detected The PDB indicates that a residue is not the true C-terminus by including only the backbone N of the next residue. This has not been observed in this PDB file. # 23 # Note: C-terminus capping The residues listed in the table below either are pseudo C-terminal residues, or have two groups attached of which neither is the normal C-terminal O. In this table REAL means that the C-terminal residue is likely to be the real C-terminus of its chain; OX means that an incorrect second oxygen (OXT) was detected that should not be there; -O indicates that the 'normal' oxygen (i.e. not the OXT) is missing; OT indicates the detection of any other capping group. C-terminal nitrogen atoms, if any, have already been dealt with in a previous check and are indicated here by -N. PSEUDO means that this is the last visible residue in the chain, but not the real C-terminus, i.e. all residues after this one are missing in this chain. BREAK means that this is the last residue before a chain-break, i.e. the chain continues but after this residue a number of residues is missing. In case a break is observed the number of residues that seems to be missing is shown in brackets. OK means that given the status (REAL, PSEUDO, BREAK), no problems were found. Be aware that we cannot easily see the difference between these errors and errors in the chain and residue numbering schemes. So do not blindly trust the table below. 14 VAL ( 148-) A - : Unknown problem # 24 # Note: No OXT found in the middle of chains No OXT groups were found in the middle of protein chains. # 25 # Note: Introduction to the nomenclature section. Nomenclature problems seem, at first, rather unimportant. After all who cares if we call the delta atoms in leucine delta2 and delta1 rather than the other way around. Chemically speaking that is correct. But structures have not been solved and deposited just for chemists to look at them. Most times a structure is used, it is by software in a bioinformatics lab. And if they compare structures in which the one used C delta1 and delta2 and the other uses C delta2 and delta1, then that comparison will fail. Also, we recalculate all structures every so many years to make sure that everybody always can get access to the best coordinates that can be obtained from the (your?) experimental data. These recalculations will be troublesome if there are nomenclature problems. Several nomenclature problems actually are worse than that. At the WHAT CHECK website [REF] you can get an overview of the importance of all nomenclature problems that we list. # 26 # Note: Valine nomenclature OK No errors were detected in valine nomenclature. # 27 # Note: Threonine nomenclature OK No errors were detected in threonine nomenclature. # 28 # Note: Isoleucine nomenclature OK No errors were detected in isoleucine nomenclature. # 29 # Note: Leucine nomenclature OK No errors were detected in leucine nomenclature. # 30 # Note: Arginine nomenclature OK No errors were detected in arginine nomenclature. # 31 # Note: Tyrosine torsion conventions OK No errors were detected in tyrosine torsion angle conventions. # 32 # Note: Phenylalanine torsion conventions OK No errors were detected in phenylalanine torsion angle conventions. # 33 # Note: Aspartic acid torsion conventions OK No errors were detected in aspartic acid torsion angle conventions. # 34 # Note: Glutamic acid torsion conventions OK No errors were detected in glutamic acid torsion angle conventions. # 35 # Note: Phosphate group names OK in DNA/RNA No errors were detected in nucleic acid phosphate group naming conventions. # 36 # Note: Heavy atom naming OK No errors were detected in the atom names for non-hydrogen atoms. Please be aware that the PDB wants us to deliberately make some nomenclature errors; especially in non-canonical amino acids. # 37 # Warning: Unusual bond lengths The bond lengths listed in the table below were found to deviate more than 4 sigma from standard bond lengths (both standard values and sigmas for amino acid residues have been taken from Engh and Huber [REF], for DNA they were taken from Parkinson et al [REF]). In the table below for each unusual bond the bond length and the number of standard deviations it differs from the normal value is given. Atom names starting with "-" belong to the previous residue in the chain. If the second atom name is "-SG*", the disulphide bridge has a deviating length. 12 ASP ( 120-) A - CA CB 1.91 19.0 12 ASP ( 120-) A - CB CG 1.89 14.8 12 ASP ( 120-) A - CG OD2 1.43 9.3 # 38 # Note: Normal bond length variability Bond lengths were found to deviate normally from the standard bond lengths (values for Protein residues were taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]). RMS Z-score for bond lengths: 0.987 RMS-deviation in bond distances: 0.020 # 39 # Warning: Unusual bond angles The bond angles listed in the table below were found to deviate more than 4 sigma from standard bond angles (both standard values and sigma for protein residues have been taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]). In the table below for each strange angle the bond angle and the number of standard deviations it differs from the standard values is given. Please note that disulphide bridges are neglected. Atoms starting with "-" belong to the previous residue in the sequence. 2 PHE ( 21-) A - CA CB CG 108.93 -4.9 3 PHE ( 38-) A - CA CB CG 108.95 -4.8 5 ASP ( 55-) A - CA CB CG 108.55 -4.0 5 TYR ( 56-) A - C CA CB 102.33 -4.1 6 PRO ( 65-) A - N CA C 97.24 -5.8 6 SER ( 69-) A - N CA C 98.68 -4.5 7 PHE ( 75-) A - CA CB CG 106.40 -7.4 7 SER ( 79-) A - -C N CA 128.99 4.0 8 TYR ( 81-) A - CA CB CG 105.54 -4.2 8 ASN ( 84-) A - -C N CA 113.85 -4.4 8 ASP ( 85-) A - -C N CA 113.04 -4.8 8 LYS ( 87-) A - -C N CA 136.68 8.3 9 HIS ( 96-) A - NE2 CD2 CG 110.61 4.1 10 ASP ( 101-) A - CA CB CG 108.33 -4.3 10 ILE ( 107-) A - -C N CA 132.51 6.0 10 GLN ( 109-) A - CB CG CD 104.72 -4.6 12 ASP ( 120-) A - N CA CB 124.84 8.4 12 ASP ( 120-) A - CA CB CG 150.90 38.3 12 ASP ( 120-) A - CB CG OD2 138.84 8.9 12 ASP ( 120-) A - CB CG OD1 100.95 -7.6 12 ASN ( 122-) A - -C N CA 132.08 5.8 12 ASN ( 122-) A - CA CB CG 105.34 -7.3 12 ALA ( 126-) A - C CA CB 104.06 -4.3 13 HIS ( 133-) A - NE2 CD2 CG 110.55 4.1 13 GLU ( 135-) A - N CA CB 117.96 4.4 13 ASP ( 138-) A - CA CB CG 107.88 -4.7 14 TYR ( 142-) A - CA CB CG 105.57 -4.2 14 ASN ( 145-) A - CA CB CG 108.13 -4.5 # 40 # Note: Normal bond angle variability Bond angles were found to deviate normally from the mean standard bond angles (normal values for protein residues were taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]). The RMS Z-score given below is expected to be near 1.0 for a normally restrained data set, and this is indeed observed for very high resolution X-ray structures. RMS Z-score for bond angles: 1.376 RMS-deviation in bond angles: 2.541 # 41 # Note: Residue hand check OK No atoms are observed that have the wrong handedness. Be aware, though, that WHAT CHECK might have corrected the handedness of some atoms already. The handedness has not been corrected for any case where the problem is worse than just an administrative discomfort. # 42 # Warning: Chirality deviations detected The atoms listed in the table below have an improper dihedral value that is deviating from expected values. As the improper dihedral values are all getting very close to ideal values in recent X-ray structures, and as we actually do not know how big the spread around these values should be, this check only warns for 6 sigma deviations. Improper dihedrals are a measure of the chirality/planarity of the structure at a specific atom. Values around -35 or +35 are expected for chiral atoms, and values around 0 for planar atoms. Planar side chains are left out of the calculations, these are better handled by the planarity checks. Three numbers are given for each atom in the table. The first is the Z-score for the improper dihedral. The second number is the measured improper dihedral. The third number is the expected value for this atom type. A final column contains an extra warning if the chirality for an atom is opposite to the expected value. 12 ASP ( 120-) A - CA -7.0 20.20 33.67 The average deviation= 1.357 # 43 # Note: Improper dihedral angle distribution OK The RMS Z-score for all improper dihedrals in the structure is within normal ranges. Improper dihedral RMS Z-score : 1.168 # 44 # Error: Tau angle problems The side chains of the residues listed in the table below contain a tau angle (N-Calpha-C) that was found to deviate from te expected value by more than 4.0 times the expected standard deviation. The number in the table is the number of standard deviations this RMS value deviates from the expected value. 6 PRO ( 65-) A - 6.11 6 SER ( 69-) A - 4.93 # 45 # Warning: High tau angle deviations The RMS Z-score for the tau angles (N-Calpha-C) in the structure is too high. For well refined structures this number is expected to be near 1.0. The fact that it is higher than 1.5 worries us. However, we determined the tau normal distributions from 500 high-resolution X-ray structures, rather than from CSD data, so we cannot be 100 percent certain about these numbers. Tau angle RMS Z-score : 1.596 # 46 # Note: Side chain planarity OK All of the side chains of residues that have an intact planar group are planar within expected RMS deviations. # 47 # Note: Atoms connected to aromatic rings OK All of the atoms that are connected to planar aromatic rings in side chains of amino-acid residues are in the plane within expected RMS deviations. Since there is no DNA and no protein with hydrogens, no uncalibrated planarity check was performed. Ramachandran Z-score : -0.279 # 48 # Note: Ramachandran Z-score OK The score expressing how well the backbone conformations of all residues correspond to the known allowed areas in the Ramachandran plot is within expected ranges for well-refined structures. Ramachandran Z-score : -0.279 # 49 # Warning: Torsion angle evaluation shows unusual residues The residues listed in the table below contain bad or abnormal torsion angles. These scores give an impression of how `normal' the torsion angles in protein residues are. All torsion angles except omega are used for calculating a `normality' score. Average values and standard deviations were obtained from the residues in the WHAT CHECK database. These are used to calculate Z-scores. A residue with a Z-score of below -2.0 is poor, and a score of less than -3.0 is worrying. For such residues more than one torsion angle is in a highly unlikely position. 9 ILE ( 97-) A - -2.6 3 LYS ( 39-) A - -2.4 6 SER ( 67-) A - -2.1 # 50 # Warning: Backbone evaluation reveals unusual conformations The residues listed in the table below have abnormal backbone torsion angles. Residues with `forbidden' phi-psi combinations are listed, as well as residues with unusual omega angles (deviating by more than 3 sigma from the normal value). Please note that it is normal if about 5 percent of the residues is listed here as having unusual phi-psi combinations. 3 LYS ( 39-) A - Poor phi/psi 5 ASP ( 55-) A - Poor phi/psi 5 TYR ( 56-) A - Poor phi/psi 6 SER ( 67-) A - Poor phi/psi 7 GLN ( 76-) A - Poor phi/psi 8 TYR ( 81-) A - omega poor 8 ASP ( 85-) A - Poor phi/psi 8 GLY ( 86-) A - omega poor 9 ARG ( 90-) A - Poor phi/psi 9 ASN ( 93-) A - Poor phi/psi 9 HIS ( 96-) A - Poor phi/psi 10 ILE ( 107-) A - omega poor 14 ASN ( 145-) A - Poor phi/psi chi-1/chi-2 correlation Z-score : -2.438 # 51 # Note: chi-1/chi-2 angle correlation Z-score OK The score expressing how well the chi-1/chi-2 angles of all residues correspond to the populated areas in the database is within expected ranges for well-refined structures. chi-1/chi-2 correlation Z-score : -2.438 # 52 # Warning: Unusual rotamers The residues listed in the table below have a rotamer that is not seen very often in the database of solved protein structures. This option determines for every residue the position specific chi-1 rotamer distribution. Thereafter it verified whether the actual residue in the molecule has the most preferred rotamer or not. If the actual rotamer is the preferred one, the score is 1.0. If the actual rotamer is unique, the score is 0.0. If there are two preferred rotamers, with a population distribution of 3:2 and your rotamer sits in the lesser populated rotamer, the score will be 0.667. No value will be given if insufficient hits are found in the database. It is not necessarily an error if a few residues have rotamer values below 0.3, but careful inspection of all residues with these low values could be worth it. 11 SER ( 119-) A - 0.37 # 53 # Warning: Unusual backbone conformations For the residues listed in the table below, the backbone formed by itself and two neighbouring residues on either side is in a conformation that is not seen very often in the database of solved protein structures. The number given in the table is the number of similar backbone conformations in the database with the same amino acid in the centre. For this check, backbone conformations are compared with database structures using C-alpha superpositions with some restraints on the backbone oxygen positions. A residue mentioned in the table can be part of a strange loop, or there might be something wrong with it or its directly surrounding residues. There are a few of these in every protein, but in any case it is worth looking at, especially if a regular DSSP secondary structure (H or S for helix or strand) is indicated! 6 PRO ( 65-) A - 0 6 GLY ( 66-) A - 0 6 SER ( 67-) A - 0 14 CYS ( 146-) A - 0 14 GLY ( 147-) A - 0 3 LYS ( 39-) A - 1 6 SER ( 69-) A - 1 8 TRP ( 82-) A - 1 12 ASN ( 122-) A - 1 13 GLU ( 135-) A - 1 7 ILE ( 74-) A - 2 12 ASP ( 120-) A - 2 13 HIS ( 133-) A - H 2 13 CYS ( 134-) A - 2 # 54 # Note: Backbone conformation Z-score OK The backbone conformation analysis gives a score that is normal for well refined protein structures. Backbone conformation Z-score : -0.760 # 55 # Note: Omega angle restraint OK The omega angles for trans-peptide bonds in a structure is expected to give a gaussian distribution with the average around +178 degrees, and a standard deviation around 5.5. In the current structure the standard deviation agrees with this expectation. Omega average and std. deviation= 181.150 4.656 # 56 # Note: PRO puckering amplitude OK Puckering amplitudes for all PRO residues are within normal ranges. # 57 # Warning: Unusual PRO puckering phases The proline residues listed in the table below have a puckering phase that is not expected to occur in protein structures. Puckering parameters were calculated by the method of Cremer and Pople [REF]. Normal PRO rings approximately show a so-called envelope conformation with the C-gamma atom above the plane of the ring (phi=+72 degrees), or a half-chair conformation with C-gamma below and C-beta above the plane of the ring (phi=-90 degrees). If phi deviates strongly from these values, this is indicative of a very strange conformation for a PRO residue, and definitely requires a manual check of the data. Be aware that this is a warning with a low confidence level. See: Who checks the checkers? Four validation tools applied to eight atomic resolution structures [REF]. PRO ( 4-) A - 101.8 envelop C-beta (108 degrees) 6 PRO ( 65-) A - -122.3 half-chair C-delta/C-gamma (-126 degrees) # 58 # Note: Backbone oxygen evaluation OK All residues for which the local backbone conformation could be found in the WHAT CHECK database have a normal backbone oxygen position. # 59 # Note: Peptide bond conformations There was no need to complain about a single amino acid # 60 # Error: Abnormally short interatomic distances The pairs of atoms listed in the table below have an unusually short interactomic distance; each bump is listed in only one direction. The contact distances of all atom pairs have been checked. Two atoms are said to `bump' if they are closer than the sum of their Van der Waals radii minus 0.40 Angstrom. For hydrogen bonded pairs a tolerance of 0.55 Angstrom is used. The first number in the table tells you how much shorter that specific contact is than the acceptable limit. The second distance is the distance between the centres of the two atoms. Although we believe that two water atoms at 2.4 A distance are too close, we only report water pairs that are closer than this rather short distance. The last text-item on each line represents the status of the atom pair. If the final column contains the text 'HB', the bump criterion was relaxed because there could be a hydrogen bond. Similarly relaxed criteria are used for 1-3 and 1-4 interactions (listed as 'B2' and 'B3', respectively). If the last column is 'BF', the sum of the B-factors of the atoms is higher than 80, which makes the appearance of the bump somewhat less severe because the atoms probably are not there anyway. BL, on the other hand, indicates that the bumping atoms both have a low B-factor, and that makes the bumps more worrisome. INTRA and INTER indicate whether the clashes are between atoms in the same asymmetric unit, or atoms in symmetry related asymmetric units, respectively. Bumps between atoms for which the sum of their occupancies is lower than one are not reported. If the MODEL number does not exist (as is the case in most X-ray files), a minus sign is printed instead. 4 VAL ( 41-) A - CG2 <-> 4 TRP ( 46-) A - NE1 0.32 2.78 INTRA BL 4 MET ( 47-) A - SD <-> 14 TYR ( 142-) A - CB 0.32 3.08 INTRA BL 2 ARG ( 23-) A - CG <-> 4 MET ( 47-) A - SD 0.32 3.08 INTRA BF 9 ILE ( 97-) A - CG1 <-> 10 GLN ( 109-) A - CD 0.27 2.93 INTRA BF 2 THR ( 29-) A - CG2 <-> 10 ILE ( 107-) A - CD1 0.27 2.93 INTRA BF 9 ILE ( 97-) A - CD1 <-> 10 GLN ( 109-) A - CD 0.26 2.94 INTRA BF 3 LEU ( 30-) A - CD2 <-> 4 TRP ( 46-) A - CB 0.26 2.94 INTRA BF 3 LEU ( 30-) A - CD1 <-> 3 LEU ( 35-) A - CD1 0.26 2.94 INTRA BF 2 ASP ( 25-) A - CA <-> 2 ARG ( 28-) A - CD 0.26 2.94 INTRA BF 3 LEU ( 33-) A - CD1 <-> 10 ILE ( 107-) A - CD1 0.26 2.94 INTRA BF 8 TRP ( 82-) A - CZ3 <-> 11 ARG ( 116-) A - CD 0.26 2.94 INTRA BF 3 LEU ( 33-) A - CD2 <-> 10 ILE ( 107-) A - CD1 0.26 2.94 INTRA BF 4 MET ( 47-) A - CE <-> 14 TYR ( 142-) A - CD1 0.26 2.94 INTRA BL LEU ( 5-) A - CD1 <-> LEU ( 7-) A - CG 0.25 2.95 INTRA BF 8 TRP ( 82-) A - CZ3 <-> 11 ARG ( 116-) A - CZ 0.25 2.95 INTRA BF LEU ( 9-) A - CD2 <-> 1 LEU ( 11-) A - CD1 0.25 2.95 INTRA BF 8 CYS ( 83-) A - CB <-> 9 ILE ( 97-) A - CG2 0.25 2.95 INTRA BF 1 LYS ( 19-) A - CG <-> 10 ASP ( 105-) A - CB 0.25 2.95 INTRA BF 10 ASP ( 101-) A - CB <-> 10 GLN ( 109-) A - NE2 0.25 2.85 INTRA BL 1 GLY ( 18-) A - CA <-> 5 LYS ( 59-) A - CE 0.25 2.95 INTRA BF 5 LYS ( 51-) A - CE <-> 5 TYR ( 56-) A - CE2 0.25 2.95 INTRA BF 13 TRP ( 130-) A - CZ3 <-> 13 GLU ( 135-) A - CB 0.25 2.95 INTRA BF 3 LEU ( 30-) A - CD2 <-> 4 LEU ( 43-) A - CD1 0.25 2.95 INTRA BF 4 VAL ( 41-) A - CG2 <-> 4 TRP ( 46-) A - CZ2 0.24 2.96 INTRA BL 2 GLU ( 22-) A - CD <-> 2 CYS ( 24-) A - N 0.24 2.86 INTRA BL 9 ILE ( 97-) A - CG1 <-> 10 GLN ( 109-) A - NE2 0.23 2.87 INTRA BF 3 LEU ( 35-) A - CD2 <-> 11 LYS ( 115-) A - CE 0.23 2.97 INTRA BL 5 TYR ( 56-) A - C <-> 7 ILE ( 74-) A - CD1 0.23 2.97 INTRA BF 13 TRP ( 130-) A - CH2 <-> 13 GLU ( 135-) A - CB 0.21 2.99 INTRA BF 4 VAL ( 41-) A - CG2 <-> 4 TRP ( 46-) A - CE2 0.21 2.99 INTRA BL 4 TRP ( 46-) A - CH2 <-> 11 VAL ( 118-) A - CG1 0.21 2.99 INTRA BL 8 TRP ( 82-) A - CZ3 <-> 11 ARG ( 116-) A - NH1 0.20 2.90 INTRA BF 11 VAL ( 111-) A - CG2 <-> 11 LYS ( 115-) A - NZ 0.20 2.90 INTRA BL 8 TRP ( 82-) A - CH2 <-> 11 VAL ( 117-) A - CA 0.20 3.00 INTRA BF 10 LEU ( 102-) A - CD2 <-> 10 GLN ( 109-) A - NE2 0.19 2.91 INTRA BL 8 ASP ( 85-) A - N <-> 9 CYS ( 99-) A - SG 0.18 3.12 INTRA BF 10 ILE ( 107-) A - CG1 <-> 10 THR ( 108-) A - N 0.18 2.82 INTRA BF 2 GLU ( 22-) A - CD <-> 2 ARG ( 23-) A - N 0.17 2.83 INTRA BF 11 VAL ( 111-) A - CG1 <-> 11 ALA ( 112-) A - N 0.16 2.84 INTRA BL 8 TRP ( 82-) A - CZ3 <-> 11 VAL ( 117-) A - CG2 0.16 3.04 INTRA BF 10 ASP ( 101-) A - CB <-> 10 GLN ( 109-) A - CD 0.16 3.04 INTRA BL 6 SER ( 67-) A - C <-> 6 SER ( 69-) A - N 0.16 2.74 INTRA BF 4 VAL ( 41-) A - CB <-> 4 ASN ( 45-) A - ND2 0.15 2.95 INTRA BF 12 ILE ( 124-) A - CG2 <-> 13 TRP ( 130-) A - CG 0.15 3.05 INTRA BF 1 LEU ( 10-) A - C <-> 1 LEU ( 11-) A - CD1 0.14 2.96 INTRA BF 7 THR ( 70-) A - CG2 <-> 7 ASP ( 71-) A - N 0.14 2.86 INTRA BL 9 CYS ( 95-) A - SG <-> 11 ARG ( 116-) A - CG 0.13 3.27 INTRA BF 8 TRP ( 82-) A - CZ3 <-> 11 ARG ( 116-) A - NE 0.12 2.98 INTRA BF 1 GLY ( 18-) A - CA <-> 5 LYS ( 59-) A - CG 0.12 3.08 INTRA BF 4 SER ( 42-) A - N <-> 4 ASN ( 45-) A - ND2 0.11 2.74 INTRA BF 1 VAL ( 14-) A - CG1 <-> 1 THR ( 15-) A - N 0.11 2.89 INTRA BF 6 ARG ( 68-) A - C <-> 6 SER ( 69-) A - C 0.11 2.69 INTRA BF 7 ILE ( 77-) A - CG2 <-> 8 TRP ( 82-) A - CB 0.10 3.10 INTRA BF 12 ARG ( 125-) A - CD <-> 13 ARG ( 131-) A - CD 0.10 3.10 INTRA BF 12 ASP ( 120-) A - CA <-> 12 PRO ( 121-) A - CD 0.10 2.70 INTRA BF 4 VAL ( 41-) A - CG1 <-> 12 ILE ( 124-) A - CG1 0.10 3.10 INTRA BF 4 MET ( 47-) A - SD <-> 14 TYR ( 142-) A - CD1 0.10 3.30 INTRA BL MET ( 1-) A - CG <-> LYS ( 2-) A - N 0.09 2.91 INTRA BF 8 TRP ( 82-) A - CZ3 <-> 11 VAL ( 117-) A - CA 0.09 3.11 INTRA BF 10 ASP ( 101-) A - CB <-> 10 GLN ( 109-) A - OE1 0.09 2.71 INTRA BL 6 SER ( 67-) A - O <-> 6 SER ( 69-) A - N 0.08 2.62 INTRA BF 14 GLN ( 141-) A - CG <-> 14 ARG ( 144-) A - NE 0.08 3.02 INTRA BF 2 GLU ( 22-) A - OE2 <-> 2 CYS ( 24-) A - N 0.08 2.62 INTRA BL 11 VAL ( 117-) A - O <-> 12 ASP ( 120-) A - N 0.08 2.62 INTRA BF 5 LYS ( 51-) A - CD <-> 5 TYR ( 56-) A - CE2 0.08 3.12 INTRA BF 13 ARG ( 131-) A - O <-> 13 GLU ( 135-) A - CD 0.07 2.73 INTRA BF 6 ASN ( 62-) A - OD1 <-> 7 ASP ( 71-) A - CB 0.07 2.73 INTRA BL 10 LYS ( 104-) A - NZ <-> 10 ASP ( 106-) A - CB 0.07 3.03 INTRA BL 11 VAL ( 118-) A - C <-> 12 ASP ( 120-) A - N 0.07 2.83 INTRA BF 2 THR ( 29-) A - O <-> 3 LEU ( 33-) A - CD1 0.07 2.73 INTRA BF 8 ASN ( 84-) A - ND2 <-> 9 ASN ( 93-) A - ND2 0.06 2.79 INTRA BF 12 PRO ( 121-) A - N <-> 12 ASN ( 122-) A - N 0.06 2.54 INTRA BL 10 THR ( 108-) A - O <-> 11 VAL ( 111-) A - CG1 0.06 2.74 INTRA BL 4 ALA ( 44-) A - CB <-> 13 VAL ( 139-) A - CB 0.06 3.14 INTRA BF 13 GLU ( 135-) A - CG <-> 13 ASN ( 136-) A - OD1 0.06 2.74 INTRA BF 9 ILE ( 97-) A - CD1 <-> 10 GLN ( 109-) A - OE1 0.06 2.74 INTRA BF 6 ASN ( 64-) A - N <-> 6 SER ( 69-) A - O 0.06 2.64 INTRA BL 2 CYS ( 24-) A - O <-> 2 ARG ( 28-) A - CD 0.06 2.74 INTRA BF 7 ASN ( 78-) A - O <-> 8 TRP ( 82-) A - CD1 0.06 2.74 INTRA BF 2 GLU ( 22-) A - OE1 <-> 2 CYS ( 24-) A - N 0.06 2.64 INTRA BL 12 ILE ( 124-) A - CG2 <-> 13 TRP ( 130-) A - CD2 0.06 3.14 INTRA BF 3 PHE ( 38-) A - O <-> 4 VAL ( 41-) A - CG2 0.05 2.75 INTRA BL 7 ASP ( 71-) A - CB <-> 7 GLN ( 76-) A - OE1 0.05 2.75 INTRA BL 11 LYS ( 115-) A - O <-> 11 VAL ( 118-) A - CG2 0.05 2.75 INTRA BL 3 LEU ( 33-) A - CD2 <-> 11 VAL ( 111-) A - CB 0.05 3.15 INTRA BF 12 ASP ( 120-) A - C <-> 12 ASN ( 122-) A - N 0.04 2.86 INTRA BF 2 ARG ( 23-) A - CD <-> 4 MET ( 47-) A - SD 0.04 3.36 INTRA BF 4 SER ( 42-) A - O <-> 4 ASN ( 45-) A - ND2 0.04 2.66 INTRA BF 4 VAL ( 41-) A - C <-> 4 ASN ( 45-) A - ND2 0.04 3.06 INTRA BF 12 ASP ( 120-) A - OD1 <-> 12 ALA ( 126-) A - CB 0.04 2.76 INTRA BF 7 GLY ( 73-) A - O <-> 7 GLN ( 76-) A - NE2 0.04 2.66 INTRA BL 8 THR ( 88-) A - CA <-> 8 PRO ( 89-) A - CD 0.04 2.76 INTRA BF 12 VAL ( 128-) A - CG2 <-> 12 ALA ( 129-) A - N 0.04 2.96 INTRA BL 14 GLN ( 141-) A - O <-> 14 ARG ( 144-) A - CG 0.03 2.77 INTRA BF MET ( 1-) A - CB <-> LYS ( 2-) A - N 0.03 2.67 INTRA BF 6 ASN ( 64-) A - C <-> 6 PRO ( 65-) A - C 0.03 2.77 INTRA BF 6 ALA ( 60-) A - CB <-> 7 GLN ( 76-) A - NE2 0.03 3.07 INTRA BL 4 MET ( 47-) A - CE <-> 5 TYR ( 56-) A - OH 0.02 2.78 INTRA BL 8 TRP ( 82-) A - CE3 <-> 11 VAL ( 117-) A - CG2 0.02 3.18 INTRA BF 6 THR ( 61-) A - OG1 <-> 7 THR ( 70-) A - CG2 0.02 2.78 INTRA BF 6 ASN ( 62-) A - ND2 <-> 7 ASP ( 71-) A - OD2 0.02 2.68 INTRA BL 7 ASN ( 78-) A - OD1 <-> 8 ARG ( 80-) A - N 0.02 2.68 INTRA BF 4 CYS ( 48-) A - SG <-> 5 TRP ( 52-) A - CD1 0.02 3.38 INTRA BL 10 ASP ( 101-) A - C <-> 10 GLN ( 109-) A - NE2 0.01 3.09 INTRA BL 5 LYS ( 51-) A - CE <-> 5 TYR ( 56-) A - OH 0.01 2.79 INTRA BF 2 ARG ( 23-) A - NH1 <-> 14 TYR ( 142-) A - O 0.01 2.69 INTRA BF 12 ILE ( 124-) A - CG2 <-> 13 TRP ( 130-) A - CD1 0.01 3.19 INTRA BF 6 GLY ( 66-) A - N <-> 6 SER ( 67-) A - N 0.01 2.59 INTRA BF 8 CYS ( 83-) A - C <-> 9 CYS ( 99-) A - SG 0.01 3.39 INTRA BL # 61 # Note: Some notes regarding these bumps The bumps have been binned in 5 categories ranging from 'should deal with' till 'must fix'. Additionally, the integrated sum of all bumps, the squared sum of all bumps, and these latter two values normalized by the number of contacts are listed too for comparison purposes between, for example, small and large proteins. Total bump value: 14.117 Total bump value per residue: 0.732 Total number of bumps: 109 Total squared bump value: 2.744 Total number of bumps in the mildest bin: 88 Total number of bumps in the second bin: 21 Total number of bumps in the middle bin: 0 Total number of bumps in the fourth bin: 0 Total number of bumps in the worst bin: 0 # 62 # Note: Inside/Outside residue distribution normal The distribution of residue types over the inside and the outside of the protein is normal. inside/outside RMS Z-score : 1.059 # 63 # Warning: Abnormal packing environment for some residues The residues listed in the table below have an unusual packing environment. The packing environment of the residues is compared with the average packing environment for all residues of the same type in good PDB files. A low packing score can indicate one of several things: Poor packing, misthreading of the sequence through the density, crystal contacts, contacts with a co-factor, or the residue is part of the active site. It is not uncommon to see a few of these, but in any case this requires further inspection of the residue. LEU ( 6-) A - -6.87 LYS ( 2-) A - -6.76 6 TYR ( 63-) A - -6.07 LEU ( 7-) A - -5.79 3 ARG ( 32-) A - -5.67 1 VAL ( 16-) A - -5.51 9 ARG ( 90-) A - -5.48 9 HIS ( 96-) A - -5.32 8 LYS ( 87-) A - -5.01 # 64 # Warning: Abnormal packing environment for sequential residues A stretch of at least three sequential residues with a questionable packing environment was found. This could indicate that these residues are part of a strange loop. It might also be an indication of misthreading in the density. However, it can also indicate that one or more residues in this stretch have other problems such as, for example, missing atoms, very weird angles or bond lengths, etc. The table below lists the first and last residue in each stretch found, as well as the average residue score of the series. 5 TRP ( 52-) A - 5 - SER 54- (A ) - -4.30 # 65 # Warning: Structural average packing environment a bit worrisome The structural average packing score is a bit low. The protein is probably threaded correctly, but either poorly refined, or it is just a protein with an unusual (but correct) structure. The average packing score of 200 highly refined X-ray structures was -0.5+/-0.4 [REF]. Average for range 1 - 149 : -1.567 All contacts : Average = -0.428 Z-score = -2.81 BB-BB contacts : Average = -0.188 Z-score = -1.31 BB-SC contacts : Average = -0.324 Z-score = -2.53 SC-BB contacts : Average = -0.399 Z-score = -2.32 SC-SC contacts : Average = -0.460 Z-score = -2.53 # 66 # Note: Second generation packing environment OK None of the individual amino acid residues has a bad packing environment. # 67 # Warning: Abnormal packing Z-score for sequential residues A stretch of at least four sequential residues with a 2nd generation packing Z-score below -1.75 was found. This could indicate that these residues are part of a strange loop or that the residues in this range are incomplete, but it might also be an indication of misthreading. The table below lists the first and last residue in each stretch found, as well as the average residue Z-score of the series. 12 GLY ( 123-) A - - 12 ALA ( 126-) A - -1.59 # 68 # Note: Structural average packing Z-score OK The structural average for the second generation packing score is within normal ranges. All contacts : Average = -0.428 Z-score = -2.81 BB-BB contacts : Average = -0.188 Z-score = -1.31 BB-SC contacts : Average = -0.324 Z-score = -2.53 SC-BB contacts : Average = -0.399 Z-score = -2.32 SC-SC contacts : Average = -0.460 Z-score = -2.53 Number of ambiguities touching ambiguities: 0 # 69 # Error: His, Asn, Gln side chain flips Listed here are Histidine, Asparagine or Glutamine residues for which the orientation determined from hydrogen bonding analysis are different from the assignment given in the input. Either they could form energetically more favourable hydrogen bonds if the terminal group was rotated by 180 degrees, or there is no assignment in the input file (atom type 'A') but an assignment could be made. Be aware, though, that if the topology could not be determined for one or more ligands, then this option will make errors. 7 GLN ( 76-) A - 8 ASN ( 84-) A - 9 HIS ( 96-) A - # 70 # Note: Histidine type assignments For all complete HIS residues in the structure a tentative assignment to HIS-D (protonated on ND1), HIS-E (protonated on NE2), or HIS-H (protonated on both ND1 and NE2, positively charged) is made based on the hydrogen bond network. A second assignment is made based on which of the Engh and Huber [REF] histidine geometries fits best to the structure. In the table below all normal histidine residues are listed. The assignment based on the geometry of the residue is listed first, together with the RMS Z-score for the fit to the Engh and Huber parameters. For all residues where the H-bond assignment is different, the assignment is listed in the last columns, together with its RMS Z-score to the Engh and Huber parameters. As always, the RMS Z-scores should be close to 1.0 if the residues were restrained to the Engh and Huber parameters during refinement, and if enough (high resolution) data is available. Please note that because the differences between the geometries of the different types are small it is possible that the geometric assignment given here does not correspond to the type used in refinement. This is especially true if the RMS Z-scores are much higher than 1.0. If the two assignments differ, or the `geometry' RMS Z-score is high, it is advisable to verify the hydrogen bond assignment, check the HIS type used during the refinement and possibly adjust it. 9 HIS ( 96-) A - HIS-D 0.36 13 HIS ( 133-) A - HIS-D 0.35 # 71 # Warning: Buried unsatisfied hydrogen bond donors The buried hydrogen bond donors listed in the table below have a hydrogen atom that is not involved in a hydrogen bond in the optimized hydrogen bond network. Hydrogen bond donors that are buried inside the protein normally use all of their hydrogens to form hydrogen bonds within the protein. If there are any non hydrogen bonded buried hydrogen bond donors in the structure they will be listed here. In very good structures the number of listed atoms will tend to zero. Waters are not listed by this option. 2 CYS ( 24-) A - N 3 ALA ( 36-) A - N 5 TYR ( 56-) A - OH 6 SER ( 69-) A - N 7 THR ( 70-) A - N 8 TYR ( 81-) A - N 8 CYS ( 83-) A - N 8 THR ( 88-) A - OG1 10 ILE ( 107-) A - N 10 GLN ( 109-) A - NE2 12 ASN ( 122-) A - N # 72 # Warning: Buried unsatisfied hydrogen bond acceptors The buried side-chain hydrogen bond acceptors listed in the table below are not involved in a hydrogen bond in the optimized hydrogen bond network. Side-chain hydrogen bond acceptors buried inside the protein normally form hydrogen bonds within the protein. If there are any not hydrogen bonded in the optimized hydrogen bond network they will be listed here. Waters are not listed by this option. 4 ASN ( 45-) A - OD1 7 GLN ( 76-) A - OE1 12 ASP ( 120-) A - OD1 # 73 # Note: Some notes regarding these donors and acceptors The donors and acceptors have been counted, also as function of their accessibility. The buried donors and acceptors have been binned in five categories ranging from not forming any hydrogen bond till forming a poor till perfect hydrogen bond. Obviously, the buried donors and acceptors with no or just a poor hydrogen bond should be a topic of concern. # 74 # Warning: No crystallisation information No, or very inadequate, crystallisation information was observed upon reading the PDB file header records. This information should be available in the form of a series of REMARK 280 lines. Without this information a few things, such as checking ions in the structure, cannot be performed optimally. # 75 # Note: No ions (of a type we can validate) in structure Since there are no ions in the structure of a type we can validate, this check will not be executed. Since there are no waters, the water check has been skipped. # 76 # Note: Content of the PDB file as interpreted by WHAT CHECK Content of the PDB file as interpreted by WHAT CHECK. WHAT CHECK has read your PDB file, and stored it internally in what is called 'the soup'. The content of this soup is listed here. An extensive explanation of all frequently used WHAT CHECK output formats can be found at swift.cmbi.ru.nl. Look under output formats. A course on reading this 'Molecules' table is part of the WHAT CHECK website. 1 1 ( 1) 148 ( 148) A Protein checkset 2 149 ( 149) 149 ( 149) A Sugar checkset 3 150 ( 148) 150 ( 148) A V O2 <- 148 checkset # 77 # Note: Summary report This is an overall summary of the quality of the structure as compared with current reliable structures. Numbers in brackets are the average and standard deviation observed for a large number of files determined with a similar resolution. The second table mostly gives an impression of how well the model conforms to common refinement restraint values. Structure Z-scores, positive is better than average: Resolution read from PDB file : -1.000 1st generation packing quality : -2.669 2nd generation packing quality : -2.806 Ramachandran plot appearance : -0.279 chi-1/chi-2 rotamer normality : -2.438 Backbone conformation : -0.760 Inside/Outside distribution : 1.059 RMS Z-scores, should be close to 1.0: Bond lengths : 0.987 Bond angles : 1.376 Omega angle restraints : 0.847 Side chain planarity : 0.367 (tight) Improper dihedral distribution : 1.168 ============== WHAT IF G.Vriend, WHAT IF: a molecular modelling and drug design program, J. Mol. Graph. 8, 52--56 (1990). WHAT_CHECK (verification routines from WHAT IF) R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola, Errors in protein structures Nature 381, 272 (1996). (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra information) Bond lengths and angles, protein residues R.Engh and R.Huber, Accurate bond and angle parameters for X-ray protein structure refinement, Acta Crystallogr. A47, 392--400 (1991). Bond lengths and angles, DNA/RNA G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman, New parameters for the refinement of nucleic acid-containing structures Acta Crystallogr. D52, 57--64 (1996). DSSP W.Kabsch and C.Sander, Dictionary of protein secondary structure: pattern recognition of hydrogen bond and geometrical features Biopolymers 22, 2577--2637 (1983). Hydrogen bond networks R.W.W.Hooft, C.Sander and G.Vriend, Positioning hydrogen atoms by optimizing hydrogen bond networks in protein structures PROTEINS, 26, 363--376 (1996). Matthews' Coefficient B.W.Matthews Solvent content of Protein Crystals J. Mol. Biol. 33, 491--497 (1968). Protein side chain planarity R.W.W. Hooft, C. Sander and G. Vriend, Verification of protein structures: side-chain planarity J. Appl. Cryst. 29, 714--716 (1996). Puckering parameters D.Cremer and J.A.Pople, A general definition of ring puckering coordinates J. Am. Chem. Soc. 97, 1354--1358 (1975). Quality Control G.Vriend and C.Sander, Quality control of protein models: directional atomic contact analysis, J. Appl. Cryst. 26, 47--60 (1993). Ramachandran plot G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan, Stereochemistry of Polypeptide Chain Conformations J. Mol. Biol. 7, 95--99 (1963). R.W.W. Hooft, C.Sander and G.Vriend, Objectively judging the quality of a protein structure from a Ramachandran plot CABIOS (1997), 13, 425--430. Symmetry Checks R.W.W.Hooft, C.Sander and G.Vriend, Reconstruction of symmetry related molecules from protein data bank (PDB) files J. Appl. Cryst. 27, 1006--1009 (1994). Tau angle W.G.Touw and G.Vriend On the complexity of Engh and Huber refinement restraints: the angle tau as example. Acta Crystallogr D 66, 1341--1350 (2010). Ion Checks I.D.Brown and K.K.Wu, Empirical Parameters for Calculating Cation-Oxygen Bond Valences Acta Cryst. B32, 1957--1959 (1975). M.Nayal and E.Di Cera, Valence Screening of Water in Protein Crystals Reveals Potential Na+ Binding Sites J.Mol.Biol. 256 228--234 (1996). P.Mueller, S.Koepke and G.M.Sheldrick, Is the bond-valence method able to identify metal atoms in protein structures? Acta Cryst. D 59 32--37 (2003). Checking checks K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al. Who checks the checkers J.Mol.Biol. (1998) 276,417-436. /home/vriend/whatif/dbdata/pdbout2html After running WHAT IF's WHAT CHECK option many things have happened to the data structure that might not be optimal for many other options. FULCHK therefore is a so-called terminal option, i.e. after running the validation option, WHAT IF will restart without any coordinates in the soup; so the molecule you just checked got deleted together with anything else you might have had in the SOUP. Option not found, try:%NO For obvious reasons $ commands are not allowed in WWW scripts. WHAT IF detected a $ in a WWW script. The command will be listed below. If this command contains something that is potentially harmful to your environment, please mail G Vriend (Vriend@cmbi.kun.nl) which $ command was detected, and from where you got this script. Option:$/home/vriend/whatif/dbdata/pdbout2html ERROR. Trying to close non-opened log file ============== WHAT IF G.Vriend, WHAT IF: a molecular modelling and drug design program, J. Mol. Graph. 8, 52--56 (1990). WHAT_CHECK (verification routines from WHAT IF) R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola, Errors in protein structures Nature 381, 272 (1996). (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra information) Bond lengths and angles, protein residues R.Engh and R.Huber, Accurate bond and angle parameters for X-ray protein structure refinement, Acta Crystallogr. A47, 392--400 (1991). Bond lengths and angles, DNA/RNA G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman, New parameters for the refinement of nucleic acid-containing structures Acta Crystallogr. D52, 57--64 (1996). DSSP W.Kabsch and C.Sander, Dictionary of protein secondary structure: pattern recognition of hydrogen bond and geometrical features Biopolymers 22, 2577--2637 (1983). Hydrogen bond networks R.W.W.Hooft, C.Sander and G.Vriend, Positioning hydrogen atoms by optimizing hydrogen bond networks in protein structures PROTEINS, 26, 363--376 (1996). Matthews' Coefficient B.W.Matthews Solvent content of Protein Crystals J. Mol. Biol. 33, 491--497 (1968). Protein side chain planarity R.W.W. Hooft, C. Sander and G. Vriend, Verification of protein structures: side-chain planarity J. Appl. Cryst. 29, 714--716 (1996). Puckering parameters D.Cremer and J.A.Pople, A general definition of ring puckering coordinates J. Am. Chem. Soc. 97, 1354--1358 (1975). Quality Control G.Vriend and C.Sander, Quality control of protein models: directional atomic contact analysis, J. Appl. Cryst. 26, 47--60 (1993). Ramachandran plot G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan, Stereochemistry of Polypeptide Chain Conformations J. Mol. Biol. 7, 95--99 (1963). R.W.W. Hooft, C.Sander and G.Vriend, Objectively judging the quality of a protein structure from a Ramachandran plot CABIOS (1997), 13, 425--430. Symmetry Checks R.W.W.Hooft, C.Sander and G.Vriend, Reconstruction of symmetry related molecules from protein data bank (PDB) files J. Appl. Cryst. 27, 1006--1009 (1994). Tau angle W.G.Touw and G.Vriend On the complexity of Engh and Huber refinement restraints: the angle tau as example. Acta Crystallogr D 66, 1341--1350 (2010). Ion Checks I.D.Brown and K.K.Wu, Empirical Parameters for Calculating Cation-Oxygen Bond Valences Acta Cryst. B32, 1957--1959 (1975). M.Nayal and E.Di Cera, Valence Screening of Water in Protein Crystals Reveals Potential Na+ Binding Sites J.Mol.Biol. 256 228--234 (1996). P.Mueller, S.Koepke and G.M.Sheldrick, Is the bond-valence method able to identify metal atoms in protein structures? Acta Cryst. D 59 32--37 (2003). Checking checks K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al. Who checks the checkers J.Mol.Biol. (1998) 276,417-436.