TBLASTN 2.2.25+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: gt_genome.fasta 1 sequences; 3,550,319 total letters Query= sp|O06986|YVDD_BACSU LOG family protein yvdD OS=Bacillus subtilis (strain 168) GN=yvdD PE=1 SV=1 Length=191 Score E Sequences producing significant alignments: (Bits) Value CP000557 CP000557.1 Geobacillus thermodenitrificans NG80-2, com... 202 1e-53 > CP000557 CP000557.1 Geobacillus thermodenitrificans NG80-2, complete genome. Length=3550319 Score = 202 bits (515), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 90/179 (51%), Positives = 133/179 (75%), Gaps = 0/179 (0%) Frame = +1 Query 1 MKTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSRVGLMGTIADAIMENGGTA 60 MK ICVF GS+ G N YK A ELG+++A +GI L+YGG + GLMG +A+A++ + G Sbjct 289720 MKAICVFCGSSYGQNSKYKEAAQELGMFLARRGITLIYGGGKAGLMGEVAEAVLGHQGHV 289899 Query 61 IGVMPSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCW 120 +G++P L EV H L+EL+ V+ MH RKAKM+E ADGFI++PGG+GTYEELFEVL W Sbjct 289900 VGIIPQFLKDREVAHDRLSELVVVDTMHTRKAKMNEAADGFIALPGGYGTYEELFEVLSW 290079 Query 121 AQIGIHQKPIGLYNVNGYFEPMMKMVKYSIQEGFSNESHLKLIHSSSRPDELIEQMQNY 179 +++G+HQKPIGL NV+G+F+P++ ++++++Q+GF+ L+LI S+ L E+M + Sbjct 290080 SRVGLHQKPIGLLNVDGFFDPLLDLLRHTVQQGFAAPQDLELIVSAGDVPTLYERMSMF 290256 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 131352849 Database: gt_genome.fasta Posted date: Oct 20, 2012 12:10 PM Number of letters in database: 3,550,319 Number of sequences in database: 1 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40