# This output was generated with AUGUSTUS (version 3.1.0).
# AUGUSTUS is a gene prediction tool written by Mario Stanke (mario.stanke@uni-greifswald.de),
# Oliver Keller, Stefanie König and Lizzy Gerischer.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# arabidopsis version. Using default transition matrix.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 324868, name = NW_003724208.1) -----
#
# Constraints/Hints:
# (none)
# Predicted genes for sequence number 1 on both strands
# start gene g1
NW_003724208.1	AUGUSTUS	gene	901	1461	0.1	-	.	g1
NW_003724208.1	AUGUSTUS	transcript	901	1461	0.1	-	.	g1.t1
NW_003724208.1	AUGUSTUS	tts	901	901	.	-	.	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	exon	901	1461	.	-	.	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	stop_codon	1198	1200	.	-	0	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	single	1198	1443	0.79	-	0	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	CDS	1198	1443	0.79	-	0	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	start_codon	1441	1443	.	-	0	transcript_id "g1.t1"; gene_id "g1";
NW_003724208.1	AUGUSTUS	tss	1461	1461	.	-	.	transcript_id "g1.t1"; gene_id "g1";
# coding sequence = [atgtacatggttagagcagtccctgcaaatgctacagacaacttgtattgtacacttctggcacactcggccattcatg
# gagtcatggcagggtacacagggtttgtttctggcccaatcaatggaaactatgcatatattccgatagcagaagtggccaatgccaagaaccctgta
# aacacaatggaccacaaatgggcttgggtcagatctgtcaacaatcagccagattttataaagaggtag]
# protein sequence = [MYMVRAVPANATDNLYCTLLAHSAIHGVMAGYTGFVSGPINGNYAYIPIAEVANAKNPVNTMDHKWAWVRSVNNQPDF
# IKR]
# end gene g1
###
# start gene g2
NW_003724208.1	AUGUSTUS	gene	13546	14493	0.3	+	.	g2
NW_003724208.1	AUGUSTUS	transcript	13546	14493	0.3	+	.	g2.t1
NW_003724208.1	AUGUSTUS	tss	13546	13546	.	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	exon	13546	13572	.	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	start_codon	13567	13569	.	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	initial	13567	13572	0.99	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	internal	13673	13784	0.95	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	terminal	14059	14321	1	+	2	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	intron	13573	13672	0.95	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	intron	13785	14058	0.98	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	CDS	13567	13572	0.99	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	CDS	13673	13784	0.95	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	exon	13673	13784	.	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	CDS	14059	14321	1	+	2	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	exon	14059	14493	.	+	.	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	stop_codon	14319	14321	.	+	0	transcript_id "g2.t1"; gene_id "g2";
NW_003724208.1	AUGUSTUS	tts	14493	14493	.	+	.	transcript_id "g2.t1"; gene_id "g2";
# coding sequence = [atgaagcaaaaggtggtactcggtgtctcccttagttacaagaagtcgtggccttgttttcttttcggcgagctcactt
# gcccttccaaagctatgaagattgtatccggtttccatggtgttgaatctgtaacatggaaagatgacaagagtaaacttgaggttactggtgagatt
# gatccggtttgcctgacaaggaagctgaggaagaaaattggacctataacaataataagcgtggaagaaaagaaagaagaaaagaaggaagaaaagaa
# agaagaaaagaaggaagaaaagaagattgaatacattggcactcaatgggttccatgtccgctggtctatgacaattacaaccctgacccctgcacca
# tcttataa]
# protein sequence = [MKQKVVLGVSLSYKKSWPCFLFGELTCPSKAMKIVSGFHGVESVTWKDDKSKLEVTGEIDPVCLTRKLRKKIGPITII
# SVEEKKEEKKEEKKEEKKEEKKIEYIGTQWVPCPLVYDNYNPDPCTIL]
# end gene g2
###
# start gene g3
NW_003724208.1	AUGUSTUS	gene	17166	18069	0.11	+	.	g3
NW_003724208.1	AUGUSTUS	transcript	17166	18069	0.11	+	.	g3.t1
NW_003724208.1	AUGUSTUS	tss	17166	17166	.	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	exon	17166	17252	.	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	start_codon	17247	17249	.	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	initial	17247	17252	0.66	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	internal	17483	17594	0.93	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	terminal	17699	17961	0.94	+	2	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	intron	17253	17482	0.65	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	intron	17595	17698	0.93	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	CDS	17247	17252	0.66	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	CDS	17483	17594	0.93	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	exon	17483	17594	.	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	CDS	17699	17961	0.94	+	2	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	exon	17699	18069	.	+	.	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	stop_codon	17959	17961	.	+	0	transcript_id "g3.t1"; gene_id "g3";
NW_003724208.1	AUGUSTUS	tts	18069	18069	.	+	.	transcript_id "g3.t1"; gene_id "g3";
# coding sequence = [atgaagcaaaaggtggtactgagcgtctcccttaattacaagaagaagtgcccatgctttatttttggcaagctcacca
# gccattccaaagccttgcagattgcagctggttcatctggagttgaatctgcagcatggaaaggcgaggacaagagtaaactcgaagttagtggtgac
# agcatcgatctgattgcactgacaaagaagctgaagaagaaaattggatacacgagtatagtaaccgttgaggaaaagaaagaagagaagaaggaaga
# aaagaaggaagaagttccagctctagtataccatccaatggggttcccacagtatcagtattatgagctcccgcccagcaaccatggcttctgcacta
# tcttctaa]
# protein sequence = [MKQKVVLSVSLNYKKKCPCFIFGKLTSHSKALQIAAGSSGVESAAWKGEDKSKLEVSGDSIDLIALTKKLKKKIGYTS
# IVTVEEKKEEKKEEKKEEVPALVYHPMGFPQYQYYELPPSNHGFCTIF]
# end gene g3
###
# start gene g4
NW_003724208.1	AUGUSTUS	gene	22115	27121	0.03	-	.	g4
NW_003724208.1	AUGUSTUS	transcript	22115	27121	0.03	-	.	g4.t1
NW_003724208.1	AUGUSTUS	tts	22115	22115	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	22115	22317	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	stop_codon	22192	22194	.	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	terminal	22192	22317	1	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	22615	22650	1	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	22759	22833	0.99	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	22927	22980	0.99	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	23076	23142	1	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	23413	23526	0.98	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	23605	23706	1	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	23824	23939	0.61	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	internal	24011	24021	0.51	-	2	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	initial	24150	24234	0.46	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	22318	22614	1	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	22651	22758	0.99	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	22834	22926	0.98	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	22981	23075	1	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	23143	23412	0.83	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	23527	23604	1	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	23707	23823	0.62	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	23940	24010	0.8	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	intron	24022	24149	0.49	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	22192	22317	1	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	22615	22650	1	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	22615	22650	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	22759	22833	0.99	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	22759	22833	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	22927	22980	0.99	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	22927	22980	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	23076	23142	1	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	23076	23142	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	23413	23526	0.98	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	23413	23526	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	23605	23706	1	-	1	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	23605	23706	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	23824	23939	0.61	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	23824	23939	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	24011	24021	0.51	-	2	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	24011	24021	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	CDS	24150	24234	0.46	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	24150	24279	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	start_codon	24232	24234	.	-	0	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	exon	26947	27121	.	-	.	transcript_id "g4.t1"; gene_id "g4";
NW_003724208.1	AUGUSTUS	tss	27121	27121	.	-	.	transcript_id "g4.t1"; gene_id "g4";
# coding sequence = [atggttgatcttttggggcatttgggtggagatctctttctttgtggatggatatatagtaggatagtctcctgcttca
# tgcgaacagttaaaaagttctctgaggactttaccatccttctatttcattatgatggtcaaacaactgaatgggatgaatttgagtggtcaaagagg
# gccattcatgtgagcgttcggagacaaacaaaatggtggtatgccaaaagatttctgcatcctgacattgtggcgccatatgactatatatttatctg
# ggatgaagatctaggagttgagcattttaatgcagaagaatatataagactagtgaggaaatatggcttggagatttcacaacctggtttagaaccta
# ataaagggttaacatggcagatgacaaaaagaagaggtgatcgagaagtccacaagtttgttgagatcatggctcctgtattttctagagatgcatgg
# cggtgtgtgtggcatatgcttcagaatgacctggcacatggttggggtcttgactttgctcttagaagatgtgtagagcctgcccatgagaaaattgg
# agttgtagattctcaatggatcattcatcaaacttttccctcgcttgggaaccaggggcaagcggagaatgggaaggcaccatggcaaggggtgaggg
# agaagtgtaaaaaagagtggaccatgtttcgagttcgcatgaccaatgccaaaaaagcatattacaaggagatgggaattaatcctaccaattccaca
# gctgaccctcacagaagctga]
# protein sequence = [MVDLLGHLGGDLFLCGWIYSRIVSCFMRTVKKFSEDFTILLFHYDGQTTEWDEFEWSKRAIHVSVRRQTKWWYAKRFL
# HPDIVAPYDYIFIWDEDLGVEHFNAEEYIRLVRKYGLEISQPGLEPNKGLTWQMTKRRGDREVHKFVEIMAPVFSRDAWRCVWHMLQNDLAHGWGLDF
# ALRRCVEPAHEKIGVVDSQWIIHQTFPSLGNQGQAENGKAPWQGVREKCKKEWTMFRVRMTNAKKAYYKEMGINPTNSTADPHRS]
# end gene g4
###
# start gene g5
NW_003724208.1	AUGUSTUS	gene	27439	27991	0.63	-	.	g5
NW_003724208.1	AUGUSTUS	transcript	27439	27991	0.63	-	.	g5.t1
NW_003724208.1	AUGUSTUS	tts	27439	27439	.	-	.	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	exon	27439	27991	.	-	.	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	stop_codon	27579	27581	.	-	0	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	single	27579	27935	1	-	0	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	CDS	27579	27935	1	-	0	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	start_codon	27933	27935	.	-	0	transcript_id "g5.t1"; gene_id "g5";
NW_003724208.1	AUGUSTUS	tss	27991	27991	.	-	.	transcript_id "g5.t1"; gene_id "g5";
# coding sequence = [atggcgtgggggcaaaaccctcttttcctattcctgaccgccgctctccttctcctcaatggaggcttcgccgcccgga
# cagaggctctcgccggtggctggcgtccgatcaagaacattagcgacccacgcgtgcaagagatcggagaattcgccgtgacggagcacaacaagcag
# gcgacggagagtctgaagttccagagcgtggtctccggcgagactcaggtggtgtcaggcaccaattaccggcttgtggtcgtggcggaggacggcgg
# cgtttcgaacaagtatgaagcagttgtttgggagaaaccttggatgggtttcagaaacctcacttcctttacgcgcgtgtag]
# protein sequence = [MAWGQNPLFLFLTAALLLLNGGFAARTEALAGGWRPIKNISDPRVQEIGEFAVTEHNKQATESLKFQSVVSGETQVVS
# GTNYRLVVVAEDGGVSNKYEAVVWEKPWMGFRNLTSFTRV]
# end gene g5
###
# start gene g6
NW_003724208.1	AUGUSTUS	gene	30596	34788	0.01	+	.	g6
NW_003724208.1	AUGUSTUS	transcript	30596	34788	0.01	+	.	g6.t1
NW_003724208.1	AUGUSTUS	tss	30596	30596	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	30596	30643	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	start_codon	30630	30632	.	+	0	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	initial	30630	30643	0.68	+	0	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	internal	30733	30879	0.71	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	internal	31207	31643	0.39	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	internal	31747	31891	0.31	+	2	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	internal	32107	32235	0.84	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	internal	33311	33817	0.2	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	terminal	34133	34370	0.19	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	30644	30732	0.68	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	30880	31206	0.63	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	31644	31746	0.35	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	31892	32106	0.83	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	32236	33310	0.54	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	intron	33818	34132	0.28	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	30630	30643	0.68	+	0	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	30733	30879	0.71	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	30733	30879	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	31207	31643	0.39	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	31207	31643	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	31747	31891	0.31	+	2	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	31747	31891	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	32107	32235	0.84	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	32107	32235	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	33311	33817	0.2	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	33311	33817	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	CDS	34133	34370	0.19	+	1	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	exon	34133	34788	.	+	.	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	stop_codon	34368	34370	.	+	0	transcript_id "g6.t1"; gene_id "g6";
NW_003724208.1	AUGUSTUS	tts	34788	34788	.	+	.	transcript_id "g6.t1"; gene_id "g6";
# coding sequence = [atggtatcagagcgtttgctgaaaattttagagactaaaaatgcatcatttactctgaaatttggagtcttgatccgta
# aatgccttcgattgaggctccgattcaaaccattgcttaagattcatcaatggcaccttaagaacagtcaagatttttacctggttaaaatcggacag
# tttaaggatcagcttaggactacaaaaaaaggatctttgaatgttgttgaatatctgtccaaaatcaagagctatgttgattctttagcttcggtcgg
# tcacattctcacagataaggaccatattgatgatattctagatgacctcactgatgagtatgatgctttcatcacctccatccttactagatctcaat
# ctgatacagtagaagaagttgaattttttattatgacacaagaagctagaattgaaaagaacgcaaaatctcttgattctgcaccaagtgccaatttt
# gccttgtcttctactaataatggttttggagatcgtgctagaagcaatttctccaccaattttggtcaaggaagaggtcaaggtattagtcaaggtaa
# tggaggtcatttcaatgctggaaactttggtttagacatgaagttgaaaggtgttactacaggtttgatccaagttttgttagtccaacctcctcttc
# tcaaaatagtggtggtcatcgtgcttatttcagctaagcctctcctcattcctcaactttgtttacaacacctgaggtctgaaacagtttatactgct
# cctctacaactgattcattctgatttatggggtccagctcctatcccttcaagtggtggttatagatactatgttcattttgtggatgcctattctaa
# attcacctgatgggtctatagggttaaagaaaatcctaatggtggtgttgaaaaatacaaagccaggttggtagccaagggctttcatcaacaagctg
# gatttgattttaatgagacttttagcccaattgtgaaaccaacaactatcaggattgtactcaccattgccttatctagaggttggagtgttaggcaa
# ttagatataaatgatgcctttttgaatggtattttacaagaggaagtgtttatgtcacaacctcaaggctttgttgatgagaaacaccctaaatatgt
# ttgtagattgcataaagctctctatggactcaagcaggcaccacgagcttggtttgagagacttcacaaagcacttctacagtttggatttgtctctt
# ccaaggcagatcaatctctttttttcaggattacatcaacccataccacctacattcttgtctttgtagatgatattttgataactggaagtaatgca
# gatgtagtaactactcttattaaactgcctaccaatgagcattggaaggctgtaaaacgcattctaaggtacttaagagcaaccatggattatgaaat
# tcatttaaagaaagctgctaagttgagttcagttggattttctgatgctgattggggtttagaccctgatgatagacaatcggtttcaggtcactgta
# tcttatttggcataatattgtgtcttggcattctagaaaacaacaagcagtttcccgttccagcatag]
# protein sequence = [MVSERLLKILETKNASFTLKFGVLIRKCLRLRLRFKPLLKIHQWHLKNSQDFYLVKIGQFKDQLRTTKKGSLNVVEYL
# SKIKSYVDSLASVGHILTDKDHIDDILDDLTDEYDAFITSILTRSQSDTVEEVEFFIMTQEARIEKNAKSLDSAPSANFALSSTNNGFGDRARSNFST
# NFGQGRGQGISQGNGGHFNAGNFGLDMKLKGVTTGLIQVLLVQPPLLKIVVVIVLISAKPLLIPQLCLQHLRSETVYTAPLQLIHSDLWGPAPIPSSG
# GYRYYVHFVDAYSKFTXWVYRVKENPNGGVEKYKARLVAKGFHQQAGFDFNETFSPIVKPTTIRIVLTIALSRGWSVRQLDINDAFLNGILQEEVFMS
# QPQGFVDEKHPKYVCRLHKALYGLKQAPRAWFERLHKALLQFGFVSSKADQSLFFRITSTHTTYILVFVDDILITGSNADVVTTLIKLPTNEHWKAVK
# RILRYLRATMDYEIHLKKAAKLSSVGFSDADWGLDPDDRQSVSGHCILFGIILCLGILENNKQFPVPA]
# end gene g6
###
# start gene g7
NW_003724208.1	AUGUSTUS	gene	36009	36411	0.49	-	.	g7
NW_003724208.1	AUGUSTUS	transcript	36009	36411	0.49	-	.	g7.t1
NW_003724208.1	AUGUSTUS	tts	36009	36009	.	-	.	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	exon	36009	36411	.	-	.	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	stop_codon	36054	36056	.	-	0	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	single	36054	36356	0.99	-	0	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	CDS	36054	36356	0.99	-	0	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	start_codon	36354	36356	.	-	0	transcript_id "g7.t1"; gene_id "g7";
NW_003724208.1	AUGUSTUS	tss	36411	36411	.	-	.	transcript_id "g7.t1"; gene_id "g7";
# coding sequence = [atggctcaagtggctcaaggggttcaactgcaatcccaagaatgggttatggtcgagaacaaagattacgatcgagtct
# caaagtacgccgtggcggaggaaaatagaaggaaaggagggcacttgaaattcaagtgcgtgattaagggatcgaagatcaatcagtggggtatcaca
# ctgtacaacctcattattgaagccacaaatgacaaccagtaccaagcatttgtttgggagacgcagtctgataaggggctcatatccttcctacagtt
# gccagggaatgatggtggccgagcttag]
# protein sequence = [MAQVAQGVQLQSQEWVMVENKDYDRVSKYAVAEENRRKGGHLKFKCVIKGSKINQWGITLYNLIIEATNDNQYQAFVW
# ETQSDKGLISFLQLPGNDGGRA]
# end gene g7
###
# start gene g8
NW_003724208.1	AUGUSTUS	gene	40106	43076	0.2	+	.	g8
NW_003724208.1	AUGUSTUS	transcript	40106	43076	0.2	+	.	g8.t1
NW_003724208.1	AUGUSTUS	tss	40106	40106	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	exon	40106	40255	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	exon	40535	41033	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	start_codon	40558	40560	.	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	initial	40558	41033	0.79	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	internal	41173	41917	0.42	+	1	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	internal	41978	42164	0.87	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	terminal	42776	42951	0.93	+	2	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	intron	41034	41172	0.42	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	intron	41918	41977	1	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	intron	42165	42775	0.87	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	CDS	40558	41033	0.79	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	CDS	41173	41917	0.42	+	1	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	exon	41173	41917	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	CDS	41978	42164	0.87	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	exon	41978	42164	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	CDS	42776	42951	0.93	+	2	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	exon	42776	43076	.	+	.	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	stop_codon	42949	42951	.	+	0	transcript_id "g8.t1"; gene_id "g8";
NW_003724208.1	AUGUSTUS	tts	43076	43076	.	+	.	transcript_id "g8.t1"; gene_id "g8";
# coding sequence = [atgtctgcgacccaagaagtgacctcatctggcccggccggtgatgcttttgaaaaatctgtagataaactgagtgtaa
# aggagttccgagaacgtttctgtatcccaaatggcgtgcttgtggattttatggacgatgaagaggtcgtgtctactgagaaagccgaaggccgtgcc
# atcaccttctcaaatgagcaatttaacgctgggctccgattccctctcccggcgctgttcaaggaattcctccattttactcagatcccaccagcctt
# catccacctcaatacagtccgggtgctgatgggatgcagcattctaaacatgctgttcaaccttgacctttcgctgttggaggttctttttgtttact
# ccctgaagaagggaaaaaatgatatcttcagtatggccgcccatctgccctctcttcaattggtgactgagttgccagattcgacgaaaggaggggcg
# aagggttttgtcggaacttatctttggtttgttgataatgcaggctcggacaggaggggtcacatagttgagtgggtagagaaagcgtcttttgttcg
# attgaataagttgttcgaaattactgccgccgagaggcagtatgcaacgctgctcactgcgcggaacctgatggctgttgtctgggagtcccgtgagt
# atgtcatcaatattctccccaggaagctgccaaagaaggtagtgcctggggagcattacattctgaaagaccttcctttctacaaggaggtgcaacag
# gcggacgctgagaaacgtcgagcgctccttgacgatcgggagaggagaaaaaaggagggaaccttacggaaggctccggggcaaaaacggtccgcgtc
# ctcccctcctgctggcgctccagcgaagaagaaaaagaagacttctgagaagggaaaggaagtggaaatcccccctcctccaaaggaggttgtaattc
# ctccttcaacctatgtgaaagaggtaacaataaaggagccggaaaatcctgtcccagtttctgtttcaagcggacccggacatcttgcgggtctgaac
# cactccggtctctcaatgtcggcggctggccgtttggccctagtggtagaagaagctacgtcaataaaccaacctagctctcctcatccagatgcaga
# tgcagcggaggcttcttgtgcggccgtatcgcctcctatggcaaccccaatggaggaaatgagggggccagcctcaaggagaccgagttcggcgcgga
# acctaaagtccggcctcctcgggcagcttcaagatcgattccaggagaccatcgaagtcagttgctcatccgttcaggatgaccatactgaggggagc
# gagacggagatggcaactgagaccccagccgtctcgatggtggtcccggatgaggcgcaaaaagaagagctggagggcgagtttgctgcggagagaga
# ggaacttgaagcggactaccaaaatcaagtggatgatatgttcttcttcggctatcgctacagtatgaagaaaaatggcattaaacgtgatgtccctt
# caattcctccgggtgaagagaaagaagctacttga]
# protein sequence = [MSATQEVTSSGPAGDAFEKSVDKLSVKEFRERFCIPNGVLVDFMDDEEVVSTEKAEGRAITFSNEQFNAGLRFPLPAL
# FKEFLHFTQIPPAFIHLNTVRVLMGCSILNMLFNLDLSLLEVLFVYSLKKGKNDIFSMAAHLPSLQLVTELPDSTKGGAKGFVGTYLWFVDNAGSDRR
# GHIVEWVEKASFVRLNKLFEITAAERQYATLLTARNLMAVVWESREYVINILPRKLPKKVVPGEHYILKDLPFYKEVQQADAEKRRALLDDRERRKKE
# GTLRKAPGQKRSASSPPAGAPAKKKKKTSEKGKEVEIPPPPKEVVIPPSTYVKEVTIKEPENPVPVSVSSGPGHLAGLNHSGLSMSAAGRLALVVEEA
# TSINQPSSPHPDADAAEASCAAVSPPMATPMEEMRGPASRRPSSARNLKSGLLGQLQDRFQETIEVSCSSVQDDHTEGSETEMATETPAVSMVVPDEA
# QKEELEGEFAAEREELEADYQNQVDDMFFFGYRYSMKKNGIKRDVPSIPPGEEKEAT]
# end gene g8
###
# start gene g9
NW_003724208.1	AUGUSTUS	gene	43086	49561	0.05	-	.	g9
NW_003724208.1	AUGUSTUS	transcript	43086	49561	0.02	-	.	g9.t1
NW_003724208.1	AUGUSTUS	tts	43086	43086	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43086	43240	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	stop_codon	43205	43207	.	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	terminal	43205	43240	0.79	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	43317	43946	0.74	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44161	44642	0.49	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44727	45109	0.62	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	45200	45872	0.26	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	45934	46261	0.2	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	46724	47474	0.28	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	47553	48489	0.49	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	48586	48797	0.68	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	initial	49361	49500	0.95	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43241	43316	0.79	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43947	44160	0.59	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	44643	44726	0.83	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45110	45199	0.67	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45873	45933	0.36	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	46262	46723	0.11	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	47475	47552	0.78	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	48490	48585	0.64	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	48798	49360	0.71	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43205	43240	0.79	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43317	43946	0.74	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43317	43946	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44161	44642	0.49	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44161	44642	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44727	45109	0.62	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44727	45109	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45200	45872	0.26	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45200	45872	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45934	46261	0.2	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45934	46261	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	46724	47474	0.28	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	46724	47474	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	47553	48489	0.49	-	2	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	47553	48489	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	48586	48797	0.68	-	1	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	48586	48797	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	49361	49500	0.95	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	49361	49561	.	-	.	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	start_codon	49498	49500	.	-	0	transcript_id "g9.t1"; gene_id "g9";
NW_003724208.1	AUGUSTUS	tss	49561	49561	.	-	.	transcript_id "g9.t1"; gene_id "g9";
# coding sequence = [atggctcaagtgctagtcggcagctttgtttggatcgaggacgtggaggatccgaaggtgcaagaagttgcaaagttca
# ccgtgatggagaaaaatgggcaggcttcatggcacctgaaatataagagcgtggttatgggggtgcgtccggacaccccgtccgaacgccttttgcaa
# gtggagcaactgaatcaagaacctatattggttgagatcgtgcgttcatccatttggcaactacgtggatcactagcgacgcgaggcctcaacattgg
# cgtcgtctgtgggaaaaattttcatttgattcagtcactagcaaagatggccacaccttcccgaagccgttcatctgaaagattaagagaggaaaacg
# ctgtattacgcatccaagcttcaacatcagggcctcctcgtcgtcagcgttcaagaggccaagtagcaaactcaaggccagagccagagtctatatat
# cctggaacagcaggagctatcccaggggcatgcaacgtgaggcctcatgagccacacatgcctatgcctcgagctcctcgtgaggaaagctcaaactc
# tactcatttctcagcaaaaagccaacgtgacagaaaatctcagttgtcaaattcaatgcgcgcaagactaggcccacaagagcctgggagatcaatgc
# taccagtagccacaacctgggcaccacgccctgaccctatggtcacccccatggtgcaaaacatgcacccgcatcgtgaccccatggtcacccccatg
# atgcggaacgttcactcgcacctagcggtacaacaagctgggggaaacctctcaagccagccaccaattggttccatcagcaaaaggctagacgacat
# gctctccatgcctttctgctctcatatcattcattacgagcctccaaagggattcctcgtaccaaaattttccacatacgatgggtccaacgacccct
# tcgatcatatcgtgcattatcgacagctcatgacgctcgatattggcaacgacgcactactgtgtaaagtgtttcccgccagcctacaaggacagacc
# ctctcatggtttcatcgcctacctcccaactctgttggcaatttcagggacctatccgaagcttttgtgggacaatacttatgctccgctcgacacaa
# gcagaacatcagcactctgcaaaacataaaaatgcaagataacgaatccttaagggagtttgtgaagcgatttggtcaggccgtactccaggtagagg
# cttgcagcatggatgctgtcctacagatcttcaaacgtgccaacaaatattcaatgctcgaagatgacgtgcgtgcagccacccagcaagttttggtt
# gccggacggccatctagaggtgatgcggaaagaaatgctaaacctccggaccggccaaggccgtccgatcgaaggcaggagggaccgagtcgcccgga
# taggccgcccctcacgcctctttccatatcatatgaaaaacttctccctatgatccaaggcctgtctgacttcaggtggcccaaaccccaaggaacgg
# acccatccacaagggatcatagcaagagatgtgccttccacaaggaacacgatcacacgacagaaacatgcagaagcctccagtatctggtcgagagg
# ctcatcatggcaggacatctaaagcaatacctccgctcaaatgctggaggaaaagtcacttcccaacatcacaaccctggagcccccagggccccagc
# cgcccccaaggccgttataaactatattaacggaggtccatctgacgaggagtacgactctaggcgaaaaaggcagaagttgttgcgggccgcatcaa
# tacgcgaacacatcaattccatccggcctgggctaactggagggggccctcgccccatagatgggacaatcattttcccaccagttgaccccacccgg
# acactacagccacatcgcgacaccctcattttgtccctagagataggagacttcgatgtgagacgcatcttggttgacccagacagcttgaccaatct
# tgaaagtactcacctcacaaacatcagctccctcatgacaccagaagagacccagagcatacaaaacgcccttagacgtaacatcttcgcatgggcac
# atgctgatatgaagggaattcatccctctattacatctcacaagcttaacgtctttccaactgccagacccgtccggcagaagattaggcgctttcac
# ccggatagacaaaaaatcatccggattgagattgacaaattgctagaagccggattcatcagagaagtagaatatccgaactggctggcaaacgtagt
# ggtggtacccaagaaagaaggaaaatggcgggtgtatcaaatcgtggattctactgctgggcaagggatgctctctttcttggatgccttctccggat
# atcatcagatccccatgtccccgtctgacgaggaaaaaatagcattcataacgccacacgacctttattgctacaaagttatgtcattcgggctcaaa
# aacgttggcgccacttatcaaagactaatgacaaaaatcttcaaacctctgataggtcacatagtagaggtatatattgatgatatcgtgattaaaag
# caaaacccgagaggagcatgttcttcatttacaagaggtttttcaccttttgaagaaatatggcatgaagctgaattcttccaaatgcgcctttggcg
# taagtgctgacaaatttctgggttttatggtcagccaaagagggatagaggtcagcccggatcaagtcaaggcagtcatggaaacacctcaccccagg
# agtaagaaggaattacagcgcctcacgggcaaactcgtcgcatcagggcgtattatagcccgcttcactgatgaattgcgacccttcttcttggcaat
# acgtaaagctggagcaagcggatggacagacagctgtcaaaacgcttttgaaaagattaaacactgtcttatgcagccgcccatcctaagcaacccca
# tcccaaaagaaaaattatacatagcattggcagacgtagaaacccggtactcaaaaatggagctaacagccttagcccttcgtagcgctgcccagaag
# ctccgcccctatttccaagcccactcggtggtcgtgctgaccgatcaaccccttcgcaacattctgcacaagccagacttaaccggaagaatgctgca
# atgggctatcgaattgagcgagtttggaatcgaattccaacccagattgtccatgaaaggccaagtaatggctgacttcgtgctagaatatgcccgaa
# ggcctaaccaacaccaggaatcaaatgaaaaagaatggtggactttgctagttgatggagcctcacgatcatcagggtccggagtcgggcttttgcta
# cagtccccaaccgacctcgctctggccctatccgtttccaagctccgggtctatagcgattcgcaactcgtagtaagacaagtccagaaagaatacga
# agccaatgacgcacgcatgacgcgatatctgactaaagtaagggacaccttacagcgattcaccgaatggacaatcgaaaagatcagacgaaccgaaa
# atgggcgcgcagaagccttggctggcatagctgcctccctccccatcaaagaagctattctattgcctgtacatgtgcaaaccaacccttctgtcaca
# gaaacctctacttgcaacaccattgaggcaaaccaagcaaacggccaagaatggacgaacagcattacagaatacctccggacagacacacaaggtcc
# gggtgcaagctgcccgtttcaccataatcgggggacacttgtacaagcgatccttcacaggaccctaccttcggtgcctaagtcactcagagacccag
# tatcttggggcatggatatagtaggacctctcccagccgcacccgcccagaagaaattcctacttgttgccacaaattacttcagtaagtgggtggaa
# gctgaagcatatgcaagcatcaaagacaaagatgtcaccaagttcgtatggaaaaatatcgtctgccgttttaaaattccacacaccattatagccga
# caatggtccacagtttgatagtattgcgttccggaatttctattcggaactgaacatccggaattcatactctacaccccgttatcctcaaagtaacg
# ggcaagcagaagccacaaacaaaactctgatcactgctttaaagaaaatactcgaacaagccaaaggaaagtgggtggaagagttgcccggcgtcctg
# tgggcttatcaaaccacacccggacgaccaacaggaaacactccattcgccctcgcatacggaatggatgcagtcatccctaccgaaatagggttacc
# cactatccggactgaggcagcaaaacaggatgatgcaagtgaggagttaagaagaaacttggattgggcagatgaagtaagagaaagcgcagccatcc
# ggatggcagattatcagcaaagggcatccgcccattacaatcgcaaaggaaattccaagccaactggaaaggaccctatataa]
# protein sequence = [MAQVLVGSFVWIEDVEDPKVQEVAKFTVMEKNGQASWHLKYKSVVMGVRPDTPSERLLQVEQLNQEPILVEIVRSSIW
# QLRGSLATRGLNIGVVCGKNFHLIQSLAKMATPSRSRSSERLREENAVLRIQASTSGPPRRQRSRGQVANSRPEPESIYPGTAGAIPGACNVRPHEPH
# MPMPRAPREESSNSTHFSAKSQRDRKSQLSNSMRARLGPQEPGRSMLPVATTWAPRPDPMVTPMVQNMHPHRDPMVTPMMRNVHSHLAVQQAGGNLSS
# QPPIGSISKRLDDMLSMPFCSHIIHYEPPKGFLVPKFSTYDGSNDPFDHIVHYRQLMTLDIGNDALLCKVFPASLQGQTLSWFHRLPPNSVGNFRDLS
# EAFVGQYLCSARHKQNISTLQNIKMQDNESLREFVKRFGQAVLQVEACSMDAVLQIFKRANKYSMLEDDVRAATQQVLVAGRPSRGDAERNAKPPDRP
# RPSDRRQEGPSRPDRPPLTPLSISYEKLLPMIQGLSDFRWPKPQGTDPSTRDHSKRCAFHKEHDHTTETCRSLQYLVERLIMAGHLKQYLRSNAGGKV
# TSQHHNPGAPRAPAAPKAVINYINGGPSDEEYDSRRKRQKLLRAASIREHINSIRPGLTGGGPRPIDGTIIFPPVDPTRTLQPHRDTLILSLEIGDFD
# VRRILVDPDSLTNLESTHLTNISSLMTPEETQSIQNALRRNIFAWAHADMKGIHPSITSHKLNVFPTARPVRQKIRRFHPDRQKIIRIEIDKLLEAGF
# IREVEYPNWLANVVVVPKKEGKWRVYQIVDSTAGQGMLSFLDAFSGYHQIPMSPSDEEKIAFITPHDLYCYKVMSFGLKNVGATYQRLMTKIFKPLIG
# HIVEVYIDDIVIKSKTREEHVLHLQEVFHLLKKYGMKLNSSKCAFGVSADKFLGFMVSQRGIEVSPDQVKAVMETPHPRSKKELQRLTGKLVASGRII
# ARFTDELRPFFLAIRKAGASGWTDSCQNAFEKIKHCLMQPPILSNPIPKEKLYIALADVETRYSKMELTALALRSAAQKLRPYFQAHSVVVLTDQPLR
# NILHKPDLTGRMLQWAIELSEFGIEFQPRLSMKGQVMADFVLEYARRPNQHQESNEKEWWTLLVDGASRSSGSGVGLLLQSPTDLALALSVSKLRVYS
# DSQLVVRQVQKEYEANDARMTRYLTKVRDTLQRFTEWTIEKIRRTENGRAEALAGIAASLPIKEAILLPVHVQTNPSVTETSTCNTIEANQANGQEWT
# NSITEYLRTDTQGPGASCPFHHNRGTLVQAILHRTLPSVPKSLRDPVSWGMDIVGPLPAAPAQKKFLLVATNYFSKWVEAEAYASIKDKDVTKFVWKN
# IVCRFKIPHTIIADNGPQFDSIAFRNFYSELNIRNSYSTPRYPQSNGQAEATNKTLITALKKILEQAKGKWVEELPGVLWAYQTTPGRPTGNTPFALA
# YGMDAVIPTEIGLPTIRTEAAKQDDASEELRRNLDWADEVRESAAIRMADYQQRASAHYNRKGNSKPTGKDPI]
NW_003724208.1	AUGUSTUS	transcript	46647	49561	0.01	-	.	g9.t2
NW_003724208.1	AUGUSTUS	tts	46647	46647	.	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	46647	47474	.	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	stop_codon	46718	46720	.	-	0	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	terminal	46718	47474	0.3	-	1	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	47553	48489	0.49	-	2	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	48586	48797	0.68	-	1	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	initial	49361	49500	0.95	-	0	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	47475	47552	0.78	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	48490	48585	0.64	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	48798	49360	0.71	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	46718	47474	0.3	-	1	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	47553	48489	0.49	-	2	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	47553	48489	.	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	48586	48797	0.68	-	1	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	48586	48797	.	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	49361	49500	0.95	-	0	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	49361	49561	.	-	.	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	start_codon	49498	49500	.	-	0	transcript_id "g9.t2"; gene_id "g9";
NW_003724208.1	AUGUSTUS	tss	49561	49561	.	-	.	transcript_id "g9.t2"; gene_id "g9";
# coding sequence = [atggctcaagtgctagtcggcagctttgtttggatcgaggacgtggaggatccgaaggtgcaagaagttgcaaagttca
# ccgtgatggagaaaaatgggcaggcttcatggcacctgaaatataagagcgtggttatgggggtgcgtccggacaccccgtccgaacgccttttgcaa
# gtggagcaactgaatcaagaacctatattggttgagatcgtgcgttcatccatttggcaactacgtggatcactagcgacgcgaggcctcaacattgg
# cgtcgtctgtgggaaaaattttcatttgattcagtcactagcaaagatggccacaccttcccgaagccgttcatctgaaagattaagagaggaaaacg
# ctgtattacgcatccaagcttcaacatcagggcctcctcgtcgtcagcgttcaagaggccaagtagcaaactcaaggccagagccagagtctatatat
# cctggaacagcaggagctatcccaggggcatgcaacgtgaggcctcatgagccacacatgcctatgcctcgagctcctcgtgaggaaagctcaaactc
# tactcatttctcagcaaaaagccaacgtgacagaaaatctcagttgtcaaattcaatgcgcgcaagactaggcccacaagagcctgggagatcaatgc
# taccagtagccacaacctgggcaccacgccctgaccctatggtcacccccatggtgcaaaacatgcacccgcatcgtgaccccatggtcacccccatg
# atgcggaacgttcactcgcacctagcggtacaacaagctgggggaaacctctcaagccagccaccaattggttccatcagcaaaaggctagacgacat
# gctctccatgcctttctgctctcatatcattcattacgagcctccaaagggattcctcgtaccaaaattttccacatacgatgggtccaacgacccct
# tcgatcatatcgtgcattatcgacagctcatgacgctcgatattggcaacgacgcactactgtgtaaagtgtttcccgccagcctacaaggacagacc
# ctctcatggtttcatcgcctacctcccaactctgttggcaatttcagggacctatccgaagcttttgtgggacaatacttatgctccgctcgacacaa
# gcagaacatcagcactctgcaaaacataaaaatgcaagataacgaatccttaagggagtttgtgaagcgatttggtcaggccgtactccaggtagagg
# cttgcagcatggatgctgtcctacagatcttcaaacgtgccaacaaatattcaatgctcgaagatgacgtgcgtgcagccacccagcaagttttggtt
# gccggacggccatctagaggtgatgcggaaagaaatgctaaacctccggaccggccaaggccgtccgatcgaaggcaggagggaccgagtcgcccgga
# taggccgcccctcacgcctctttccatatcatatgaaaaacttctccctatgatccaaggcctgtctgacttcaggtggcccaaaccccaaggaacgg
# acccatccacaagggatcatagcaagagatgtgccttccacaaggaacacgatcacacgacagaaacatgcagaagcctccagtatctggtcgagagg
# ctcatcatggcaggacatctaaagcaatacctccgctcaaatgctggaggaaaagtcacttcccaacatcacaaccctggagcccccagggccccagc
# cgcccccaaggccgttataaactatattaacggaggtccatctgacgaggagtacgactctaggcgaaaaaggcagaagttgttgcgggccgcatcaa
# tacgcgaacacatcaattccatccggcctgggctaactggagggggccctcgccccatagatgggacaatcattttcccaccagttgaccccacccgg
# acactacagccacatcgcgacaccctcattttgtccctagagataggagacttcgatgtgagacgcatcttggttgacccagacagcttgaccaatct
# tgtataa]
# protein sequence = [MAQVLVGSFVWIEDVEDPKVQEVAKFTVMEKNGQASWHLKYKSVVMGVRPDTPSERLLQVEQLNQEPILVEIVRSSIW
# QLRGSLATRGLNIGVVCGKNFHLIQSLAKMATPSRSRSSERLREENAVLRIQASTSGPPRRQRSRGQVANSRPEPESIYPGTAGAIPGACNVRPHEPH
# MPMPRAPREESSNSTHFSAKSQRDRKSQLSNSMRARLGPQEPGRSMLPVATTWAPRPDPMVTPMVQNMHPHRDPMVTPMMRNVHSHLAVQQAGGNLSS
# QPPIGSISKRLDDMLSMPFCSHIIHYEPPKGFLVPKFSTYDGSNDPFDHIVHYRQLMTLDIGNDALLCKVFPASLQGQTLSWFHRLPPNSVGNFRDLS
# EAFVGQYLCSARHKQNISTLQNIKMQDNESLREFVKRFGQAVLQVEACSMDAVLQIFKRANKYSMLEDDVRAATQQVLVAGRPSRGDAERNAKPPDRP
# RPSDRRQEGPSRPDRPPLTPLSISYEKLLPMIQGLSDFRWPKPQGTDPSTRDHSKRCAFHKEHDHTTETCRSLQYLVERLIMAGHLKQYLRSNAGGKV
# TSQHHNPGAPRAPAAPKAVINYINGGPSDEEYDSRRKRQKLLRAASIREHINSIRPGLTGGGPRPIDGTIIFPPVDPTRTLQPHRDTLILSLEIGDFD
# VRRILVDPDSLTNLV]
NW_003724208.1	AUGUSTUS	transcript	43086	46321	0.01	-	.	g9.t3
NW_003724208.1	AUGUSTUS	tts	43086	43086	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43086	43240	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	stop_codon	43205	43207	.	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	terminal	43205	43240	0.79	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	43317	43946	0.74	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44161	44642	0.49	-	2	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44727	45109	0.62	-	1	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	45200	45872	0.26	-	2	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	initial	45934	46228	0.24	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43241	43316	0.79	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43947	44160	0.59	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	44643	44726	0.83	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45110	45199	0.67	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45873	45933	0.36	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43205	43240	0.79	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43317	43946	0.74	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43317	43946	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44161	44642	0.49	-	2	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44161	44642	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44727	45109	0.62	-	1	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44727	45109	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45200	45872	0.26	-	2	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45200	45872	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45934	46228	0.24	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45934	46321	.	-	.	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	start_codon	46226	46228	.	-	0	transcript_id "g9.t3"; gene_id "g9";
NW_003724208.1	AUGUSTUS	tss	46321	46321	.	-	.	transcript_id "g9.t3"; gene_id "g9";
# coding sequence = [atgacaccagaagagacccagagcatacaaaacgcccttagacgtaacatcttcgcatgggcacatgctgatatgaagg
# gaattcatccctctattacatctcacaagcttaacgtctttccaactgccagacccgtccggcagaagattaggcgctttcacccggatagacaaaaa
# atcatccggattgagattgacaaattgctagaagccggattcatcagagaagtagaatatccgaactggctggcaaacgtagtggtggtacccaagaa
# agaaggaaaatggcgggtgtatcaaatcgtggattctactgctgggcaagggatgctctctttcttggatgccttctccggatatcatcagatcccca
# tgtccccgtctgacgaggaaaaaatagcattcataacgccacacgacctttattgctacaaagttatgtcattcgggctcaaaaacgttggcgccact
# tatcaaagactaatgacaaaaatcttcaaacctctgataggtcacatagtagaggtatatattgatgatatcgtgattaaaagcaaaacccgagagga
# gcatgttcttcatttacaagaggtttttcaccttttgaagaaatatggcatgaagctgaattcttccaaatgcgcctttggcgtaagtgctgacaaat
# ttctgggttttatggtcagccaaagagggatagaggtcagcccggatcaagtcaaggcagtcatggaaacacctcaccccaggagtaagaaggaatta
# cagcgcctcacgggcaaactcgtcgcatcagggcgtattatagcccgcttcactgatgaattgcgacccttcttcttggcaatacgtaaagctggagc
# aagcggatggacagacagctgtcaaaacgcttttgaaaagattaaacactgtcttatgcagccgcccatcctaagcaaccccatcccaaaagaaaaat
# tatacatagcattggcagacgtagaaacccggtactcaaaaatggagctaacagccttagcccttcgtagcgctgcccagaagctccgcccctatttc
# caagcccactcggtggtcgtgctgaccgatcaaccccttcgcaacattctgcacaagccagacttaaccggaagaatgctgcaatgggctatcgaatt
# gagcgagtttggaatcgaattccaacccagattgtccatgaaaggccaagtaatggctgacttcgtgctagaatatgcccgaaggcctaaccaacacc
# aggaatcaaatgaaaaagaatggtggactttgctagttgatggagcctcacgatcatcagggtccggagtcgggcttttgctacagtccccaaccgac
# ctcgctctggccctatccgtttccaagctccgggtctatagcgattcgcaactcgtagtaagacaagtccagaaagaatacgaagccaatgacgcacg
# catgacgcgatatctgactaaagtaagggacaccttacagcgattcaccgaatggacaatcgaaaagatcagacgaaccgaaaatgggcgcgcagaag
# ccttggctggcatagctgcctccctccccatcaaagaagctattctattgcctgtacatgtgcaaaccaacccttctgtcacagaaacctctacttgc
# aacaccattgaggcaaaccaagcaaacggccaagaatggacgaacagcattacagaatacctccggacagacacacaaggtccgggtgcaagctgccc
# gtttcaccataatcgggggacacttgtacaagcgatccttcacaggaccctaccttcggtgcctaagtcactcagagacccagtatcttggggcatgg
# atatagtaggacctctcccagccgcacccgcccagaagaaattcctacttgttgccacaaattacttcagtaagtgggtggaagctgaagcatatgca
# agcatcaaagacaaagatgtcaccaagttcgtatggaaaaatatcgtctgccgttttaaaattccacacaccattatagccgacaatggtccacagtt
# tgatagtattgcgttccggaatttctattcggaactgaacatccggaattcatactctacaccccgttatcctcaaagtaacgggcaagcagaagcca
# caaacaaaactctgatcactgctttaaagaaaatactcgaacaagccaaaggaaagtgggtggaagagttgcccggcgtcctgtgggcttatcaaacc
# acacccggacgaccaacaggaaacactccattcgccctcgcatacggaatggatgcagtcatccctaccgaaatagggttacccactatccggactga
# ggcagcaaaacaggatgatgcaagtgaggagttaagaagaaacttggattgggcagatgaagtaagagaaagcgcagccatccggatggcagattatc
# agcaaagggcatccgcccattacaatcgcaaaggaaattccaagccaactggaaaggaccctatataa]
# protein sequence = [MTPEETQSIQNALRRNIFAWAHADMKGIHPSITSHKLNVFPTARPVRQKIRRFHPDRQKIIRIEIDKLLEAGFIREVE
# YPNWLANVVVVPKKEGKWRVYQIVDSTAGQGMLSFLDAFSGYHQIPMSPSDEEKIAFITPHDLYCYKVMSFGLKNVGATYQRLMTKIFKPLIGHIVEV
# YIDDIVIKSKTREEHVLHLQEVFHLLKKYGMKLNSSKCAFGVSADKFLGFMVSQRGIEVSPDQVKAVMETPHPRSKKELQRLTGKLVASGRIIARFTD
# ELRPFFLAIRKAGASGWTDSCQNAFEKIKHCLMQPPILSNPIPKEKLYIALADVETRYSKMELTALALRSAAQKLRPYFQAHSVVVLTDQPLRNILHK
# PDLTGRMLQWAIELSEFGIEFQPRLSMKGQVMADFVLEYARRPNQHQESNEKEWWTLLVDGASRSSGSGVGLLLQSPTDLALALSVSKLRVYSDSQLV
# VRQVQKEYEANDARMTRYLTKVRDTLQRFTEWTIEKIRRTENGRAEALAGIAASLPIKEAILLPVHVQTNPSVTETSTCNTIEANQANGQEWTNSITE
# YLRTDTQGPGASCPFHHNRGTLVQAILHRTLPSVPKSLRDPVSWGMDIVGPLPAAPAQKKFLLVATNYFSKWVEAEAYASIKDKDVTKFVWKNIVCRF
# KIPHTIIADNGPQFDSIAFRNFYSELNIRNSYSTPRYPQSNGQAEATNKTLITALKKILEQAKGKWVEELPGVLWAYQTTPGRPTGNTPFALAYGMDA
# VIPTEIGLPTIRTEAAKQDDASEELRRNLDWADEVRESAAIRMADYQQRASAHYNRKGNSKPTGKDPI]
NW_003724208.1	AUGUSTUS	transcript	43086	46341	0.01	-	.	g9.t4
NW_003724208.1	AUGUSTUS	tts	43086	43086	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43086	43240	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	stop_codon	43205	43207	.	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	terminal	43205	43240	0.79	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	43317	43946	0.74	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44161	44642	0.49	-	2	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	44727	45109	0.62	-	1	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	internal	45200	45842	0.21	-	2	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	initial	45934	46228	0.24	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43241	43316	0.79	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	43947	44160	0.59	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	44643	44726	0.83	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45110	45199	0.67	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	intron	45843	45933	0.24	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43205	43240	0.79	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	43317	43946	0.74	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	43317	43946	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44161	44642	0.49	-	2	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44161	44642	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	44727	45109	0.62	-	1	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	44727	45109	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45200	45842	0.21	-	2	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45200	45842	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	CDS	45934	46228	0.24	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	exon	45934	46341	.	-	.	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	start_codon	46226	46228	.	-	0	transcript_id "g9.t4"; gene_id "g9";
NW_003724208.1	AUGUSTUS	tss	46341	46341	.	-	.	transcript_id "g9.t4"; gene_id "g9";
# coding sequence = [atgacaccagaagagacccagagcatacaaaacgcccttagacgtaacatcttcgcatgggcacatgctgatatgaagg
# gaattcatccctctattacatctcacaagcttaacgtctttccaactgccagacccgtccggcagaagattaggcgctttcacccggatagacaaaaa
# atcatccggattgagattgacaaattgctagaagccggattcatcagagaagtagaatatccgaactggctggcaaacgtagtggtggtacccaagaa
# agaaggaaaatggcgggtgtggatgctctctttcttggatgccttctccggatatcatcagatccccatgtccccgtctgacgaggaaaaaatagcat
# tcataacgccacacgacctttattgctacaaagttatgtcattcgggctcaaaaacgttggcgccacttatcaaagactaatgacaaaaatcttcaaa
# cctctgataggtcacatagtagaggtatatattgatgatatcgtgattaaaagcaaaacccgagaggagcatgttcttcatttacaagaggtttttca
# ccttttgaagaaatatggcatgaagctgaattcttccaaatgcgcctttggcgtaagtgctgacaaatttctgggttttatggtcagccaaagaggga
# tagaggtcagcccggatcaagtcaaggcagtcatggaaacacctcaccccaggagtaagaaggaattacagcgcctcacgggcaaactcgtcgcatca
# gggcgtattatagcccgcttcactgatgaattgcgacccttcttcttggcaatacgtaaagctggagcaagcggatggacagacagctgtcaaaacgc
# ttttgaaaagattaaacactgtcttatgcagccgcccatcctaagcaaccccatcccaaaagaaaaattatacatagcattggcagacgtagaaaccc
# ggtactcaaaaatggagctaacagccttagcccttcgtagcgctgcccagaagctccgcccctatttccaagcccactcggtggtcgtgctgaccgat
# caaccccttcgcaacattctgcacaagccagacttaaccggaagaatgctgcaatgggctatcgaattgagcgagtttggaatcgaattccaacccag
# attgtccatgaaaggccaagtaatggctgacttcgtgctagaatatgcccgaaggcctaaccaacaccaggaatcaaatgaaaaagaatggtggactt
# tgctagttgatggagcctcacgatcatcagggtccggagtcgggcttttgctacagtccccaaccgacctcgctctggccctatccgtttccaagctc
# cgggtctatagcgattcgcaactcgtagtaagacaagtccagaaagaatacgaagccaatgacgcacgcatgacgcgatatctgactaaagtaaggga
# caccttacagcgattcaccgaatggacaatcgaaaagatcagacgaaccgaaaatgggcgcgcagaagccttggctggcatagctgcctccctcccca
# tcaaagaagctattctattgcctgtacatgtgcaaaccaacccttctgtcacagaaacctctacttgcaacaccattgaggcaaaccaagcaaacggc
# caagaatggacgaacagcattacagaatacctccggacagacacacaaggtccgggtgcaagctgcccgtttcaccataatcgggggacacttgtaca
# agcgatccttcacaggaccctaccttcggtgcctaagtcactcagagacccagtatcttggggcatggatatagtaggacctctcccagccgcacccg
# cccagaagaaattcctacttgttgccacaaattacttcagtaagtgggtggaagctgaagcatatgcaagcatcaaagacaaagatgtcaccaagttc
# gtatggaaaaatatcgtctgccgttttaaaattccacacaccattatagccgacaatggtccacagtttgatagtattgcgttccggaatttctattc
# ggaactgaacatccggaattcatactctacaccccgttatcctcaaagtaacgggcaagcagaagccacaaacaaaactctgatcactgctttaaaga
# aaatactcgaacaagccaaaggaaagtgggtggaagagttgcccggcgtcctgtgggcttatcaaaccacacccggacgaccaacaggaaacactcca
# ttcgccctcgcatacggaatggatgcagtcatccctaccgaaatagggttacccactatccggactgaggcagcaaaacaggatgatgcaagtgagga
# gttaagaagaaacttggattgggcagatgaagtaagagaaagcgcagccatccggatggcagattatcagcaaagggcatccgcccattacaatcgca
# aaggaaattccaagccaactggaaaggaccctatataa]
# protein sequence = [MTPEETQSIQNALRRNIFAWAHADMKGIHPSITSHKLNVFPTARPVRQKIRRFHPDRQKIIRIEIDKLLEAGFIREVE
# YPNWLANVVVVPKKEGKWRVWMLSFLDAFSGYHQIPMSPSDEEKIAFITPHDLYCYKVMSFGLKNVGATYQRLMTKIFKPLIGHIVEVYIDDIVIKSK
# TREEHVLHLQEVFHLLKKYGMKLNSSKCAFGVSADKFLGFMVSQRGIEVSPDQVKAVMETPHPRSKKELQRLTGKLVASGRIIARFTDELRPFFLAIR
# KAGASGWTDSCQNAFEKIKHCLMQPPILSNPIPKEKLYIALADVETRYSKMELTALALRSAAQKLRPYFQAHSVVVLTDQPLRNILHKPDLTGRMLQW
# AIELSEFGIEFQPRLSMKGQVMADFVLEYARRPNQHQESNEKEWWTLLVDGASRSSGSGVGLLLQSPTDLALALSVSKLRVYSDSQLVVRQVQKEYEA
# NDARMTRYLTKVRDTLQRFTEWTIEKIRRTENGRAEALAGIAASLPIKEAILLPVHVQTNPSVTETSTCNTIEANQANGQEWTNSITEYLRTDTQGPG
# ASCPFHHNRGTLVQAILHRTLPSVPKSLRDPVSWGMDIVGPLPAAPAQKKFLLVATNYFSKWVEAEAYASIKDKDVTKFVWKNIVCRFKIPHTIIADN
# GPQFDSIAFRNFYSELNIRNSYSTPRYPQSNGQAEATNKTLITALKKILEQAKGKWVEELPGVLWAYQTTPGRPTGNTPFALAYGMDAVIPTEIGLPT
# IRTEAAKQDDASEELRRNLDWADEVRESAAIRMADYQQRASAHYNRKGNSKPTGKDPI]
# end gene g9
###
# start gene g10
NW_003724208.1	AUGUSTUS	gene	52640	56141	0.33	-	.	g10
NW_003724208.1	AUGUSTUS	transcript	52640	56141	0.33	-	.	g10.t1
NW_003724208.1	AUGUSTUS	tts	52640	52640	.	-	.	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	exon	52640	52926	.	-	.	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	exon	55638	56141	.	-	.	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	stop_codon	55639	55641	.	-	0	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	single	55639	56079	0.98	-	0	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	CDS	55639	56079	0.98	-	0	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	start_codon	56077	56079	.	-	0	transcript_id "g10.t1"; gene_id "g10";
NW_003724208.1	AUGUSTUS	tss	56141	56141	.	-	.	transcript_id "g10.t1"; gene_id "g10";
# coding sequence = [atggctcaggttcagctccaccgccacacggctcccctgaaactcgacggagcaatgactcacatggatctgggcggaa
# tcataactcaactggaaggtgacaaatggattcggaaccacaatgtatttcagctgcaattattgggagagttcgccgtgaaggagaaaaacaggaag
# gcgaactggcacctggaattcattaacgtgtacgaggggtggtatcagcgcctctccagaggccgcggccgcattcacctactccatcttgtagccaa
# acacgaagacgtcttgaccaactacgaggcatatgtttgggagaaggtcgatcgtcctctggattgggagaaggtcgatcgtcctctggattggaaga
# ggatggatcttcctctggagctcaggtccctttctcctatggtccttgatgaagaccccagcgcttaa]
# protein sequence = [MAQVQLHRHTAPLKLDGAMTHMDLGGIITQLEGDKWIRNHNVFQLQLLGEFAVKEKNRKANWHLEFINVYEGWYQRLS
# RGRGRIHLLHLVAKHEDVLTNYEAYVWEKVDRPLDWEKVDRPLDWKRMDLPLELRSLSPMVLDEDPSA]
# end gene g10
###
# start gene g11
NW_003724208.1	AUGUSTUS	gene	58426	67231	0.03	-	.	g11
NW_003724208.1	AUGUSTUS	transcript	58426	67231	0.03	-	.	g11.t1
NW_003724208.1	AUGUSTUS	tts	58426	58426	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	exon	58426	58895	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	stop_codon	58595	58597	.	-	0	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	terminal	58595	58895	0.97	-	1	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	internal	58969	59221	0.34	-	2	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	internal	59441	59784	0.66	-	1	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	initial	59857	59891	1	-	0	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	intron	58896	58968	0.78	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	intron	59222	59440	0.34	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	intron	59785	59856	0.97	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	CDS	58595	58895	0.97	-	1	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	CDS	58969	59221	0.34	-	2	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	exon	58969	59221	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	CDS	59441	59784	0.66	-	1	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	exon	59441	59784	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	CDS	59857	59891	1	-	0	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	exon	59857	59927	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	start_codon	59889	59891	.	-	0	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	exon	67171	67231	.	-	.	transcript_id "g11.t1"; gene_id "g11";
NW_003724208.1	AUGUSTUS	tss	67231	67231	.	-	.	transcript_id "g11.t1"; gene_id "g11";
# coding sequence = [atggatgctcttgaaggccaatctggggtcgacacgtggtggtctggccgttttgaggagtgcttttgggaaggctgca
# gagtagtggtgcagggggtggctgttgctgcagagttggttggaggggcaaatccgggagaaaagaaagctgttacagaggaggagaaggaagaggag
# cttttgttgggttactttgggggactagaaggaattgagaaagaaataaaacaaacaaagctgccctcgaacgacgccggcggcttgcctccggcggc
# gaagcgcctctgtcatcaccggaacgccaagcaaccacagccatggactcatgatcagcgagggtcccagcttcgtggctctctcaccatcaggcttt
# gcaattacaatcccaccaagttttgcaatatcggggactcagattccagagttcacttcaagaataccagggtgactactcgggcaaccagtatgttg
# cttttgaccatggccagagggtatttggaggacgccctagtccgcgagcaaaccatgcctttcacccgtttttgtagaggtattccgtcaatggtgaa
# catggtcaagcttactgctcacttcccatttgatctatttctctctcacttggtcgtttcattagaatctgttggaccatccaaaattgaaaaagaaa
# agggagaattatcacctaatggtgattttgaggaggataatcttgttgtctatggagatgctagtacccaggttgtgcctttggcaaagcacaatcct
# ggaagacggccattccgagcgggtgatggacaagagagggattgtcaggttgttggaggagaaagtggtgcagatgctgatgatgaggatggtgaaaa
# cgcttctgaggctggtgaagatgtctcagctagtgagtctgcaggtgatgagtgctctcgaggagagtag]
# protein sequence = [MDALEGQSGVDTWWSGRFEECFWEGCRVVVQGVAVAAELVGGANPGEKKAVTEEEKEEELLLGYFGGLEGIEKEIKQT
# KLPSNDAGGLPPAAKRLCHHRNAKQPQPWTHDQRGSQLRGSLTIRLCNYNPTKFCNIGDSDSRVHFKNTRVTTRATSMLLLTMARGYLEDALVREQTM
# PFTRFCRGIPSMVNMVKLTAHFPFDLFLSHLVVSLESVGPSKIEKEKGELSPNGDFEEDNLVVYGDASTQVVPLAKHNPGRRPFRAGDGQERDCQVVG
# GESGADADDEDGENASEAGEDVSASESAGDECSRGE]
# end gene g11
###
# start gene g12
NW_003724208.1	AUGUSTUS	gene	67846	68491	0.22	-	.	g12
NW_003724208.1	AUGUSTUS	transcript	67846	68491	0.22	-	.	g12.t1
NW_003724208.1	AUGUSTUS	tts	67846	67846	.	-	.	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	exon	67846	68491	.	-	.	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	stop_codon	67995	67997	.	-	0	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	single	67995	68432	0.97	-	0	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	CDS	67995	68432	0.97	-	0	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	start_codon	68430	68432	.	-	0	transcript_id "g12.t1"; gene_id "g12";
NW_003724208.1	AUGUSTUS	tss	68491	68491	.	-	.	transcript_id "g12.t1"; gene_id "g12";
# coding sequence = [atggctcaggtgcaaccctaccgcaacatggctcccctgaaactcgacggagcaaatactcagatagatctaggcggaa
# aaataactacactggaaagcaaactatggactccgaaccacgacgaagatctgctgcaattgttgggaatgttctccgtgatggagcacaacagggag
# aagggctgcagtctgaaattcgttaacacgtatgaagggtggtatcagactctcccccaaaaccgcggcacccttcacaaaatccatcttgtagccac
# agacaaaggcgtcccgggcaactacgaagcatgtgtctgggagaagaattgtactcaggattggaagaagatgaatcttcctctggacgcgcacctga
# tgaagattcatctggagctcgtgtacttcattcgtctgtgcccggaaatagagccgcgcgcttaa]
# protein sequence = [MAQVQPYRNMAPLKLDGANTQIDLGGKITTLESKLWTPNHDEDLLQLLGMFSVMEHNREKGCSLKFVNTYEGWYQTLP
# QNRGTLHKIHLVATDKGVPGNYEACVWEKNCTQDWKKMNLPLDAHLMKIHLELVYFIRLCPEIEPRA]
# end gene g12
###
# start gene g13
NW_003724208.1	AUGUSTUS	gene	70286	71946	0.19	+	.	g13
NW_003724208.1	AUGUSTUS	transcript	70286	71946	0.19	+	.	g13.t1
NW_003724208.1	AUGUSTUS	tss	70286	70286	.	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	exon	70286	70809	.	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	start_codon	70509	70511	.	+	0	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	initial	70509	70809	0.96	+	0	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	internal	71139	71418	1	+	2	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	terminal	71632	71770	0.87	+	1	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	intron	70810	71138	0.96	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	intron	71419	71631	1	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	CDS	70509	70809	0.96	+	0	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	CDS	71139	71418	1	+	2	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	exon	71139	71418	.	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	CDS	71632	71770	0.87	+	1	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	exon	71632	71946	.	+	.	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	stop_codon	71768	71770	.	+	0	transcript_id "g13.t1"; gene_id "g13";
NW_003724208.1	AUGUSTUS	tts	71946	71946	.	+	.	transcript_id "g13.t1"; gene_id "g13";
# coding sequence = [atgaaagcagggaaatcctggaggtttggtggttcaaactccaggagccatgtgagaaggtcgcgggcgagccagacac
# atgcctcgcgcgcaccatgggcaagtcagatgtgcaccgcgggcgagccagacgcgcaccgcaggcgatccagacgcgcatcgcaggcgagccagacg
# cgcaccgcacgcgcaccacgggtgagccaaacaggcaccgtgggcaagccagacacacaccgtgggcgagccagacatgcaccgcatgcgcaccagat
# ggggatcgcgtgcacacctgacttaggcacgagggcgcttaagccttgtgcggtgagccagctgatgaaaccatgggtgcaatgccatggtctgatgg
# ctccaatagatgactcgcaccaagttgcctacgcacaatacaggggcgccatgtcctgtgcaccaagaaggattggccataggtgcaatgccatggct
# cgttgttgggaagctgggaagcaagcaacaagcccaagccatgggcacctagacatggcacgggctcacacatcagtgtggggaaggcacactgatgc
# accagatgcttgttggctgaggaatgatggctggtgcaagtgggtggcaggagcagaccactatctgggtggtgggtggttttgcaaggcagttgagg
# gcggttcaggccagttgcataaaccacctagttggctccaagatttgaattag]
# protein sequence = [MKAGKSWRFGGSNSRSHVRRSRASQTHASRAPWASQMCTAGEPDAHRRRSRRASQASQTRTARAPRVSQTGTVGKPDT
# HRGRARHAPHAHQMGIACTPDLGTRALKPCAVSQLMKPWVQCHGLMAPIDDSHQVAYAQYRGAMSCAPRRIGHRCNAMARCWEAGKQATSPSHGHLDM
# ARAHTSVWGRHTDAPDACWLRNDGWCKWVAGADHYLGGGWFCKAVEGGSGQLHKPPSWLQDLN]
# end gene g13
###
# start gene g14
NW_003724208.1	AUGUSTUS	gene	73141	73711	0.18	-	.	g14
NW_003724208.1	AUGUSTUS	transcript	73141	73711	0.18	-	.	g14.t1
NW_003724208.1	AUGUSTUS	tts	73141	73141	.	-	.	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	exon	73141	73711	.	-	.	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	stop_codon	73206	73208	.	-	0	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	single	73206	73646	0.96	-	0	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	CDS	73206	73646	0.96	-	0	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	start_codon	73644	73646	.	-	0	transcript_id "g14.t1"; gene_id "g14";
NW_003724208.1	AUGUSTUS	tss	73711	73711	.	-	.	transcript_id "g14.t1"; gene_id "g14";
# coding sequence = [atggctcaggtgcaaccctgccgcaacatggctcccctgaaactcgacggagcaaatactcagatagatctaggcggaa
# acataaccacagtgcaaagccaaaaatggattccgaaccacaacgtaattcaactgcaaatcttgggagcgtactccgtgatggagcacaacgtgaga
# acgcgctccagcctggagttcgttaacacgtatgaaggatggtatcagcgcctcctcggaaaactcggcatccttcacaaaatccatcttgtagccac
# agacaacggcgtcccgggcacctacgaggcatgggtttgggagaagtacgattgtcctctggattggaagaagatgaatcttccttcggatttgaccc
# agatgaagcttcctctggtgctcttgtacttcattcctctgagcccggaaatagagccgcgcgcttaa]
# protein sequence = [MAQVQPCRNMAPLKLDGANTQIDLGGNITTVQSQKWIPNHNVIQLQILGAYSVMEHNVRTRSSLEFVNTYEGWYQRLL
# GKLGILHKIHLVATDNGVPGTYEAWVWEKYDCPLDWKKMNLPSDLTQMKLPLVLLYFIPLSPEIEPRA]
# end gene g14
###
# start gene g15
NW_003724208.1	AUGUSTUS	gene	80447	81791	0.17	-	.	g15
NW_003724208.1	AUGUSTUS	transcript	80447	81791	0.17	-	.	g15.t1
NW_003724208.1	AUGUSTUS	tts	80447	80447	.	-	.	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	exon	80447	80824	.	-	.	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	stop_codon	80547	80549	.	-	0	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	terminal	80547	80824	0.77	-	2	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	initial	81318	81723	0.75	-	0	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	intron	80825	81317	0.77	-	.	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	CDS	80547	80824	0.77	-	2	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	CDS	81318	81723	0.75	-	0	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	exon	81318	81791	.	-	.	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	start_codon	81721	81723	.	-	0	transcript_id "g15.t1"; gene_id "g15";
NW_003724208.1	AUGUSTUS	tss	81791	81791	.	-	.	transcript_id "g15.t1"; gene_id "g15";
# coding sequence = [atggctcaggtgcaaccctaccgcaacatggctcccctgaaactcgacggagcaaatactcagatagatctaggcggaa
# aaataactacactggaaagcaaacgatggactccgaaccacaacgtaggtcagctgcaattcttgggaacgttctccgtgatggagcacaacaggagg
# acgggctcctgcctgaaattcgttaacacgtatgaagggtggtatcagcgcctccccgaagaccaaggcatccttcacaaactccatcttgtagccac
# agacaaaggcgtcccgggcaactacgaagcatgtgtctgggagaagaattgtcctctggattggaagaagatgaatcttcctctggacgaggaccaga
# tgaatcttcatctggagctcgtgtacttcattccgcctccccgaagaccaaggcatccttcacaaactccatcttgtagccacagacaaaggcgtccc
# gggcaactacgaagcatgtgtctgggagaagaattgtcctctggattggaagaagatgaatcttcctctggacgaggaccagatgaatcttcatctgg
# agctcgtgtacttcattcgtctgtgcctagggatggcaatggggcgggtcatttcgggtacccgccccgccccgcccctaatggggtgggatattatt
# tttctaaacgggtatag]
# protein sequence = [MAQVQPYRNMAPLKLDGANTQIDLGGKITTLESKRWTPNHNVGQLQFLGTFSVMEHNRRTGSCLKFVNTYEGWYQRLP
# EDQGILHKLHLVATDKGVPGNYEACVWEKNCPLDWKKMNLPLDEDQMNLHLELVYFIPPPRRPRHPSQTPSCSHRQRRPGQLRSMCLGEELSSGLEED
# ESSSGRGPDESSSGARVLHSSVPRDGNGAGHFGYPPRPAPNGVGYYFSKRV]
# end gene g15
###
# start gene g16
NW_003724208.1	AUGUSTUS	gene	89746	91569	0.33	+	.	g16
NW_003724208.1	AUGUSTUS	transcript	89746	91569	0.33	+	.	g16.t1
NW_003724208.1	AUGUSTUS	tss	89746	89746	.	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	exon	89746	89861	.	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	start_codon	89856	89858	.	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	initial	89856	89861	0.98	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	internal	89947	90028	0.95	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	terminal	91241	91506	0.89	+	2	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	intron	89862	89946	0.97	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	intron	90029	91240	0.88	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	CDS	89856	89861	0.98	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	CDS	89947	90028	0.95	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	exon	89947	90028	.	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	CDS	91241	91506	0.89	+	2	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	exon	91241	91569	.	+	.	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	stop_codon	91504	91506	.	+	0	transcript_id "g16.t1"; gene_id "g16";
NW_003724208.1	AUGUSTUS	tts	91569	91569	.	+	.	transcript_id "g16.t1"; gene_id "g16";
# coding sequence = [atgaagcaaaaggtggtgatcagtgtctccttcaatggcaacaagaattgtcagtccaaagccttgaagattgcagctg
# gtttttcaggtgttaactctacagcattagaaggtgaggacaagaatcaaattgttgttgtaggtgagaacatcgatgtgattgagctcgtaaagaag
# ttgaagaagaaggttggattctctacactcaatagtgtgactctggtggatggagaagaaaaagaggaggacgaagaagagaagcctattgagtggcc
# acaccatcaagtgggcataccacattattacctctatgatgttcctttaaatcgctcaaacgactgtagtatcctctaa]
# protein sequence = [MKQKVVISVSFNGNKNCQSKALKIAAGFSGVNSTALEGEDKNQIVVVGENIDVIELVKKLKKKVGFSTLNSVTLVDGE
# EKEEDEEEKPIEWPHHQVGIPHYYLYDVPLNRSNDCSIL]
# end gene g16
###
# start gene g17
NW_003724208.1	AUGUSTUS	gene	92759	93311	0.67	-	.	g17
NW_003724208.1	AUGUSTUS	transcript	92759	93311	0.67	-	.	g17.t1
NW_003724208.1	AUGUSTUS	tts	92759	92759	.	-	.	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	exon	92759	93311	.	-	.	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	stop_codon	92943	92945	.	-	0	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	single	92943	93281	0.98	-	0	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	CDS	92943	93281	0.98	-	0	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	start_codon	93279	93281	.	-	0	transcript_id "g17.t1"; gene_id "g17";
NW_003724208.1	AUGUSTUS	tss	93311	93311	.	-	.	transcript_id "g17.t1"; gene_id "g17";
# coding sequence = [atggcgcgggggcaataccgtctttctctcctcctggcttcgctcctcctcgtcgcagtagcctccgatgctcttctcg
# gcggctggagcccgatcgaggacgtgaagaaccctcacgtgcaagagatcgggaagttcgcggtggaggcgcacaacaagttgaccgcgacgaagctg
# aagttccagagcgtgataaagggccagactcaggtcgtcgccggcaccaactaccggctaacggtgatggccaagaacggcgccgcatcgaagaagta
# cgaggcggttgtttgggagaagctggatggcaccaagcagctcacttcctttcaacccgtctga]
# protein sequence = [MARGQYRLSLLLASLLLVAVASDALLGGWSPIEDVKNPHVQEIGKFAVEAHNKLTATKLKFQSVIKGQTQVVAGTNYR
# LTVMAKNGAASKKYEAVVWEKLDGTKQLTSFQPV]
# end gene g17
###
# start gene g18
NW_003724208.1	AUGUSTUS	gene	93462	94131	0.08	-	.	g18
NW_003724208.1	AUGUSTUS	transcript	93462	94131	0.08	-	.	g18.t1
NW_003724208.1	AUGUSTUS	tts	93462	93462	.	-	.	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	exon	93462	94131	.	-	.	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	stop_codon	93730	93732	.	-	0	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	single	93730	94092	0.92	-	0	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	CDS	93730	94092	0.92	-	0	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	start_codon	94090	94092	.	-	0	transcript_id "g18.t1"; gene_id "g18";
NW_003724208.1	AUGUSTUS	tss	94131	94131	.	-	.	transcript_id "g18.t1"; gene_id "g18";
# coding sequence = [atggaacttcaaagtcagttcttgtgccggctcttctgtgtcttcgtcttcatcattttaagtgcaaatgcagcagccc
# cagtgacagcgggtggatggaatgagattccggacgtgatcaacaacactcacgttcaagatttaggcatgtttgcagtgctggcatacaacaactcc
# accgcctccagcctgtttttctatgcggtgtttcaggctcaagcgcagattgccgaaggcctgaatgttaggatggtgattcaagcacttgaaagtga
# gctgccaaagatgtataaagcttatgtgtgggagaaaccatgggagaacttcaagaaccttaccttctttgagcctgttctggtctaa]
# protein sequence = [MELQSQFLCRLFCVFVFIILSANAAAPVTAGGWNEIPDVINNTHVQDLGMFAVLAYNNSTASSLFFYAVFQAQAQIAE
# GLNVRMVIQALESELPKMYKAYVWEKPWENFKNLTFFEPVLV]
# end gene g18
###
# start gene g19
NW_003724208.1	AUGUSTUS	gene	94832	97731	0.6	-	.	g19
NW_003724208.1	AUGUSTUS	transcript	94832	97731	0.6	-	.	g19.t1
NW_003724208.1	AUGUSTUS	tts	94832	94832	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	94832	95155	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	stop_codon	95121	95123	.	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	terminal	95121	95155	0.91	-	2	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	internal	95233	95743	1	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	internal	95834	95929	0.99	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	internal	96293	96336	1	-	2	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	internal	96443	96920	0.89	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	initial	97256	97687	1	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	intron	95156	95232	0.94	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	intron	95744	95833	0.99	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	intron	95930	96292	1	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	intron	96337	96442	0.99	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	intron	96921	97255	0.99	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	95121	95155	0.91	-	2	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	95233	95743	1	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	95233	95743	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	95834	95929	0.99	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	95834	95929	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	96293	96336	1	-	2	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	96293	96336	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	96443	96920	0.89	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	96443	96920	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	CDS	97256	97687	1	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	exon	97256	97731	.	-	.	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	start_codon	97685	97687	.	-	0	transcript_id "g19.t1"; gene_id "g19";
NW_003724208.1	AUGUSTUS	tss	97731	97731	.	-	.	transcript_id "g19.t1"; gene_id "g19";
# coding sequence = [atgaatagtgagcataacacgaatggggtttctgatgacctcaaagctccactgcttccagtccaggcgaccacaatgg
# agacctcaaatggggcgtctctcatgtccattttcacacccaagagcttcttcatcctcttggggcctctgctctgcaccctcatctgcctttttgtg
# aagcttgatggccctgtgaccagcaggaacatgttggctgttcttgcttggatgtttgcttggtggatcactgaagctgtgcctatgcccatcacctc
# catgtctcctctcttcctctttcccctctttggaatcgcttccgcagatgatgttgctcactcctacatggatgatgtgatttcccttgttcttggaa
# gcttcatacttgctcttgctgttgagcattacaacatccatagaagattggccctcaatattaccttgatcttttgtggagatccactgaatccccca
# ttgcttctccttggcatctgtgccaccacagcctttgtgagtatgtggatgcacaatgttgcagcagcactgatgatgatgcccgtagccactggtat
# cttacagaggctaccatcaggtccaactcgatctccccatgtggataaattctgcagagcagtggtgcttggggtgttatactctgctgcagttgggg
# gaatgagcactctcaccggtactggcgtcaatctcatattggtaggaatgtggaagagctacttcccagaggcagaccccatcagctttaatacatgg
# ttcttctttggcttccctttggctttgctggttttctttgccttgtgggctattctctgctgcttgtactgctccaggggtgcaggtcctgctctgtc
# tgcttatttggacaaatccagtctcagaagagagcttcaaatgttgggtccaatggcttttgctgaaaagatggtgttggctgtgttttcgatgctaa
# tagtcttatggatgacaaggagcataacagatgatgttcctggatggggagctctcttcaatggtcgtgtaggcgatgggactgccagtgtgatgatg
# gcaaccttattgttcataattccaaacaagaaacaaaagggggagaagctgatggactggaacaaatgcaagaagctgccatggaacatcgtattgct
# actaggcgctggctttgccatagctgccggagtccggtcaagtggcctggctgatgtgttgtcaaaggccttgactttcctggaacacgctccctact
# tggtcattgcgcctgccgtctgtctcataagtagtacggttactgagttcacctcaaacaattccacaacaacactccttgttccccttctcatccaa
# gtagcccaaaccatgcacgtccacccgctccttctcatggttcctggagccattggagcacagttttcttacttgctgcccactggaactccttcgaa
# tgtcgtcgggttcacaacaggacacattgaaatcaaagatatgatcaagacaggagtgcctcttaagattgctggaattgctgcattatcccttctaa
# tgccttcactcggagcatatgtttttgggacaaacgaagaaatgtga]
# protein sequence = [MNSEHNTNGVSDDLKAPLLPVQATTMETSNGASLMSIFTPKSFFILLGPLLCTLICLFVKLDGPVTSRNMLAVLAWMF
# AWWITEAVPMPITSMSPLFLFPLFGIASADDVAHSYMDDVISLVLGSFILALAVEHYNIHRRLALNITLIFCGDPLNPPLLLLGICATTAFVSMWMHN
# VAAALMMMPVATGILQRLPSGPTRSPHVDKFCRAVVLGVLYSAAVGGMSTLTGTGVNLILVGMWKSYFPEADPISFNTWFFFGFPLALLVFFALWAIL
# CCLYCSRGAGPALSAYLDKSSLRRELQMLGPMAFAEKMVLAVFSMLIVLWMTRSITDDVPGWGALFNGRVGDGTASVMMATLLFIIPNKKQKGEKLMD
# WNKCKKLPWNIVLLLGAGFAIAAGVRSSGLADVLSKALTFLEHAPYLVIAPAVCLISSTVTEFTSNNSTTTLLVPLLIQVAQTMHVHPLLLMVPGAIG
# AQFSYLLPTGTPSNVVGFTTGHIEIKDMIKTGVPLKIAGIAALSLLMPSLGAYVFGTNEEM]
# end gene g19
###
# start gene g20
NW_003724208.1	AUGUSTUS	gene	107686	110420	0.06	+	.	g20
NW_003724208.1	AUGUSTUS	transcript	107686	110420	0.06	+	.	g20.t1
NW_003724208.1	AUGUSTUS	tss	107686	107686	.	+	.	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	exon	107686	110420	.	+	.	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	start_codon	108118	108120	.	+	0	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	single	108118	109968	0.95	+	0	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	CDS	108118	109968	0.95	+	0	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	stop_codon	109966	109968	.	+	0	transcript_id "g20.t1"; gene_id "g20";
NW_003724208.1	AUGUSTUS	tts	110420	110420	.	+	.	transcript_id "g20.t1"; gene_id "g20";
# coding sequence = [atgtctctcgtagaaacctcctccatcgactgcgtccaccaacgcctcgatcgtctttcctcgaagcgaaaattggacg
# attattcctcccccgccgatgacgatttctctgatttagtctccttcagaatgagaaaattcgatcaaaacgccttcgtttcttgcaactctccgccg
# gactctcatctcgagaggcatagggttgtcgatgcccgatcgtgtcccagttcgtgcagcgccgagtcggctcggcctgattcgcggttgcagttctt
# cgtgaggatgatctccgaggggaatactctggtgattcacgcgaattcggatgataccgtggagtcgctgcaccaccggattcagtcgattacgggga
# ttccggtgatggagcagcggctgatatacagagggaagcagctgcagtgggagcagtctttggctgaatgttcgattcaaaacgacgccgggcttcaa
# cttgtcggtcggatgcggagtacggaacatccggcggcatggcgagtcgctagcgagatggtgtcaacgatttgtcggctttgtaggggggaaacatt
# ccggccgttgaagaacatcaaatcgcagttgttggagttcttgatgctcactccaaaagacgacaccgagtcagcggccggttatcttcaggttttca
# tgtcttcgtcggccccttcagctttggtcatgctctacatgtccccgactaagagtaacaaggagactgcagatgatactattaggcaatttcttaac
# tcgagtcggaatttattaccaaagtctgtacaaatacaatgtgttcctatagtgttagaattttgtaagttgcttagtagaactgatcatgaggatcc
# gttgtatttgacatgccgaagcactcttgggtcgctggtggaaaatgttggggtagtgagagcttcgaggtattgtcataatagtaagacattgattg
# tagttaaagagattttaccatttgttagtgagctggctagtagcttgtcaaagtcattgatatcaagcatggaatcagcagggagcacagggaactca
# ctaaatgatgggcgcaatttgattgcagggcatacattagcaaatgatgtgcgtgattttactgcattcttgcacccggtgcgatctgtgattatgga
# gcaagtgagttttcatggtcctatttcaattccacttggagaacgtggtagtactaatccctggtatggagaagagattgagtttcttcatggcattt
# tcatcgatttgatgacaaaaatggatgggtgtctccataaaatggagcaatgcttggcaggggaaggtggagttgatcatcatactgtatggccccag
# tatcttgccgttctgaaggaattgaatagcatttctaaattatatcatggtgctgaggaagagttttggacatttatgagacgtaggaagattgcagt
# gtgctctctaatgattagatatgcaaagagaagtgatgaccatagttggcttcttgagcacaaggatgtgactgattttgaatcaaggaggcatttgg
# caatgatgatgttccctgaagtaaaggaagactatgaagaactacatgaaatgctcattgacaggtcacaattattggcagagtcattcgagtacatt
# gcacgggcagagcgtgaatctctacatggtggtctgttcatggaattcaaaaatgaggaagctacaggacctggtgtgttgagagagtggttcttctt
# ggtatgccaagaaattttcaatccacaaaatgccctttttgtagcatgcccaaatgatcgcagaaggttctttcctaatcctggtaagcttcctccat
# ctctctag]
# protein sequence = [MSLVETSSIDCVHQRLDRLSSKRKLDDYSSPADDDFSDLVSFRMRKFDQNAFVSCNSPPDSHLERHRVVDARSCPSSC
# SAESARPDSRLQFFVRMISEGNTLVIHANSDDTVESLHHRIQSITGIPVMEQRLIYRGKQLQWEQSLAECSIQNDAGLQLVGRMRSTEHPAAWRVASE
# MVSTICRLCRGETFRPLKNIKSQLLEFLMLTPKDDTESAAGYLQVFMSSSAPSALVMLYMSPTKSNKETADDTIRQFLNSSRNLLPKSVQIQCVPIVL
# EFCKLLSRTDHEDPLYLTCRSTLGSLVENVGVVRASRYCHNSKTLIVVKEILPFVSELASSLSKSLISSMESAGSTGNSLNDGRNLIAGHTLANDVRD
# FTAFLHPVRSVIMEQVSFHGPISIPLGERGSTNPWYGEEIEFLHGIFIDLMTKMDGCLHKMEQCLAGEGGVDHHTVWPQYLAVLKELNSISKLYHGAE
# EEFWTFMRRRKIAVCSLMIRYAKRSDDHSWLLEHKDVTDFESRRHLAMMMFPEVKEDYEELHEMLIDRSQLLAESFEYIARAERESLHGGLFMEFKNE
# EATGPGVLREWFFLVCQEIFNPQNALFVACPNDRRRFFPNPGKLPPSL]
# end gene g20
###
# start gene g21
NW_003724208.1	AUGUSTUS	gene	114986	122318	0.01	+	.	g21
NW_003724208.1	AUGUSTUS	transcript	114986	122318	0.01	+	.	g21.t1
NW_003724208.1	AUGUSTUS	tss	114986	114986	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	114986	115050	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	115120	115196	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	116155	117125	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	start_codon	116213	116215	.	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	initial	116213	117125	0.98	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	internal	117211	117731	0.72	+	2	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	internal	117804	118529	0.53	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	internal	118676	119384	0.17	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	internal	119481	119584	0.53	+	2	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	terminal	119708	122092	0.13	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	intron	117126	117210	0.88	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	intron	117732	117803	0.74	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	intron	118530	118675	0.53	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	intron	119385	119480	0.26	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	intron	119585	119707	0.16	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	116213	117125	0.98	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	117211	117731	0.72	+	2	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	117211	117731	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	117804	118529	0.53	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	117804	118529	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	118676	119384	0.17	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	118676	119384	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	119481	119584	0.53	+	2	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	119481	119584	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	CDS	119708	122092	0.13	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	exon	119708	122318	.	+	.	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	stop_codon	122090	122092	.	+	0	transcript_id "g21.t1"; gene_id "g21";
NW_003724208.1	AUGUSTUS	tts	122318	122318	.	+	.	transcript_id "g21.t1"; gene_id "g21";
# coding sequence = [atgagagagagagcgagagagggcgaaagagagggcgacgacgagtgcgatggtgaggaggaggaggagaaatcggcgt
# cgcaaatcagaaggaaggagagcaggtttacaatgaaatccaaggcgttcgagattgtagtggaggaaagaaaaggaaagatccaaggacgcattgtg
# gagaagaagggaggggcctcgtcatgggtacgactgggatcggatagcttagcgtttttcttggaagggttgaatctctgtatcaagggtgagaaaga
# aactagatggggaagggaatggaaggagcaggggagagtgtattctatgactcgagggacaaacagagcgggggggtttatacggcaaggggtctccg
# atatagaggggaagaggttctgcatcttcgtcccgagaggtcgtagggataagagggggtggacgaccatggcgaagaagcttaaccaggtgttaggg
# ttttttggtaaaaacccagaaaaccagaagggaaaggctgtggagaaggttgctatgggaagatcgtatgcaacaatggtgggaaaatcactgtcggg
# taactcaaatgtcgttgcagtgaaggtgaaaaaggaggaatcagaaggattaatacagaaattgaaacattgtgtagtggcgagctggagagatgggt
# cagggggagaagatgatatggagaaattggggcaagtttgggcaaagtcttgggacctcaaaggtaacctagggctggctaagctaaacaagagaaaa
# gcgctgctggattttgagaatttggaagaggctagacgagtcgtttcctctgggagctgcgtgttggaaggaacccaggtaaggctggaacactggag
# ccctaggagtggatgttgggcagaggggggaagagagaaaggaagcctggtcgatgaacatacgaaatcgatgggagatcttcaatgggccagaatct
# tagtgaaattgagaggggaagctagaccgagcgtgctggaaattgaaggggaggaagagagttacgcaatgtccttatggtgggaatgttggccggtg
# gtgaggaggaagtgcaggaacgaagccgatcgccatagcagggaggttaggggagaggaggtttcacgcgcggggcagcgagtgaggaaggattgggt
# gagtgggaggctcgagtcgctgcaaccgtcagacgaagtgacggatgtgcagggggttgggtcgggtcgggttgagatcagtccagatctaagcccga
# caacccggacgtgggtttcatttggtgaaataaatcctttaagcccaatcacgggcccaaagggaacaaggagggatggtgggcctggcttaatgatc
# gggtccatggatttgaagaaaaaaggagtggctgcaagtgtttttgtcccagacgcaggtccatcgtgcggcagggaggatgcctgcacccaacagcc
# cgatcaaggcggaaaaataagggagggcccaaaatcaccaacagtccaagaggtgacgggtttgctgctgaagtattctgcacccaactaccctccag
# aagcagagacttttgttgcgagggagactgaggacacaaggaagctacaaggagtggttaggctgacagagatggatagggcgcttgaagaggaatca
# atgaggtatggaatggggtccggttcctgggggaaaagggcattgggggattctcatctcaattcttttctttttgatcggactctggggggggagtt
# tttcgatcgttctagggatttggatgaggaaggtcgggccgataattcaatgtggttaacagtgtatgaggcttgcaatgaaaggattaaggaatgta
# aggaactgggagtcatcaaatgtagcagtgacaaaggtagggagatggaaggggtaggcgacatagatgatgctcaagttgagagaagtaagccggag
# ggtaaatgggaagagagtggtttggcgaggttcagccagttcctgggctttcctacggagggactggagaaggaaatactaactttcttgaccaagat
# caggaaaagacgggagaaaattcatagcaaagagttactggaaaagtctaagtttgaaagggagttaaaaagactggaatgctccataaactatgagg
# gaggggtgaaacagaaaggctcggagacaaaattgcagtgtatgacggatagcattgcgagaagtataggctccgggagatttctaggctggaaagca
# gtgaatgcggagggagcttcgggaggtatttttatatgctgggatagaaggttgctggacatgctagactgggaggagggacagtttactttgtcttg
# cagattccgaaatgtagaaaatgagattgtctgggtatttacgggagtgtatggccctttctctaaggtagagagggatgctttatgggaagagtttg
# gggcgattagagggctgtgggaggatccttggtgcatagggggggattttaatatcactttgttttcgagtgaaaggagtagtcagaggagaattagc
# tcagcaatgaggaaatttgcggaaactgtgaatgatcttgggttggtggatcttcctcttcaggggggagattttacttggaatgggggcctaaataa
# tcagacttgggcacgtttggacaggttccttgtgtctcctagttggatagatcaattcagtgggattaaccagtgcaggctgccccgtccggtatctg
# atcatttcccaattatgttagtggggggtgggataagacgaggcccgaccccattcagatttgaaaatatgtggcttaaggctgagggttttaaagag
# cttgttcgtagctggtggcaaggaattgatgttaggggcagtgctactctgcaacagctggaattctgggatagggaggaaaatgatagaattctgac
# tatggaggaatcagagcttaagaaagaggcaaaagaaaactacagaaaatggagaattaagatcaatggggaatggtttctagaggagcaggaaatta
# gagaaggaattgctaatgcgtttaaagagcttctttcagaagatacggagtggaaggcggatattgggagtcttcagtttgatcagatcagtcaagaa
# gaggctgagatattggagaggccttttacagaggaagaaatccatggggctctgatggagatgaatggggataaagcccctggtccggatggttttac
# tttggccttttggcaaagctgttgggagtttattaaagaggagattctagaaatgttcaaggaattctatgatcatagctctttcctcaagagcctta
# acaatactttattggttttgatccccaagaaatatggggctgagaaccttggagactttagacctattagtctcttagggggtctttacaagttattg
# gctaaagtgctggctaacagattgaagatagtggttggtaaggtggtctctacttctcagaatgcctttgtgaggggaagacaaattcttgacgcttc
# tttaattgcaaatgaagtgatagactcatggcaaaaacgaaaagaaaagggacttatatgcaaactggatatagaaaaagcttatgacagtatcaatt
# ggaagtttttgttgaaggtgttgcagaaaatgggttttgggtctaagtgggtgaggtggatgtggagttgtctatcttcagctaaattttcagtgatg
# gttaatggagtgcctgcaggcttctttcctagctctaaaggtcttagacaaggagatcccctgtctccttatctctttgttatgggaatggaagtgct
# agatgttcttattaggagagctgtggaggagggattcttatcagggtgtaacataaggggcggtagtgaacctcctttgaatatctctcacttgctct
# ttgctggcgataccattatattctgcgaggccaggaaggatcatctaactcatttaagttggattttattctggtttgaagcggcgtcaggcctaagg
# attaatctagccaagagtgaaatcattccagttggagaggtggtggagatggaggagttggctgttgagctaggttgtagggtggggtctttaccttc
# tcagtacttgggcctacccttaggggttctcaatagagcgccctatatgtgggatggggtggaagagagagtcaggaggagactagctctttggaaaa
# ggcaatatatctctaaagggggaagagtcactttaataaaaagtactttgtctagtatgccaatctaccaaatgtctatcttcaggatgcccaagatg
# gttgctagaagacttgagaaagtgcaaagggattttttgtggggaaggggaaatatggaggggaaaactcacttggtaaattgggaggtggtatgtac
# agataaggataaaggtgggctaggcattaggaagctagctatgttgaacaaagcattacttggcaagtggatatggaggtatgcttgtgacaaagata
# atctttggaaacaagtgatcaaggtgaagtatggactggaggactttggttggaggccaaagaaggctaggggggcagtgggagtaggggtttggaag
# gagatttggaaagaatcagagtggtgctggaataacatgatcttcaaagtagggaagggcaacacgatcagattttggacagatgtgtggtgttcaga
# gagagcattgtcccattgttttcctcatctctttggcatggcggttcaaaggaactcaacggttgaggaaatgtgggatcaaagttcgggtcaaggaa
# attggaatctaaattttttgagggacttcaatgattgggaattggagttggttggggattttcttcagatattgaggggtcacaaaccctcttgggaa
# gaaaattcagtcctgtggagaaaaggaagaagcgggcaattcagggtcaaggaagtgtataatctgctggcgagggctgatgatacaggttttccttc
# aagaagcatttgggtgacaagggtgccaactaaagtttgtttttttgcgtgggaggcgacgtgggggaggatcctgactttggatagacttcaaagaa
# gaggactacaacttccaaatcgctgcttcctgtgtggttgtgaggaagaaagtgtaaatcatatccttatacactgtacagtggttagagctctatgg
# gatatagtgtttggtttagtagacgtgaaatgggttttcccagaaactgtaaaggaggttttagttagttggaggggttcgtttgtgggaaagaaaag
# gaaaaagacttgggatgctattccgttgtgtattttttggacggtgtggaaggagaggaatagattagcttttaggggggggtaa]
# protein sequence = [MRERAREGEREGDDECDGEEEEEKSASQIRRKESRFTMKSKAFEIVVEERKGKIQGRIVEKKGGASSWVRLGSDSLAF
# FLEGLNLCIKGEKETRWGREWKEQGRVYSMTRGTNRAGGFIRQGVSDIEGKRFCIFVPRGRRDKRGWTTMAKKLNQVLGFFGKNPENQKGKAVEKVAM
# GRSYATMVGKSLSGNSNVVAVKVKKEESEGLIQKLKHCVVASWRDGSGGEDDMEKLGQVWAKSWDLKGNLGLAKLNKRKALLDFENLEEARRVVSSGS
# CVLEGTQVRLEHWSPRSGCWAEGGREKGSLVDEHTKSMGDLQWARILVKLRGEARPSVLEIEGEEESYAMSLWWECWPVVRRKCRNEADRHSREVRGE
# EVSRAGQRVRKDWVSGRLESLQPSDEVTDVQGVGSGRVEISPDLSPTTRTWVSFGEINPLSPITGPKGTRRDGGPGLMIGSMDLKKKGVAASVFVPDA
# GPSCGREDACTQQPDQGGKIREGPKSPTVQEVTGLLLKYSAPNYPPEAETFVARETEDTRKLQGVVRLTEMDRALEEESMRYGMGSGSWGKRALGDSH
# LNSFLFDRTLGGEFFDRSRDLDEEGRADNSMWLTVYEACNERIKECKELGVIKCSSDKGREMEGVGDIDDAQVERSKPEGKWEESGLARFSQFLGFPT
# EGLEKEILTFLTKIRKRREKIHSKELLEKSKFERELKRLECSINYEGGVKQKGSETKLQCMTDSIARSIGSGRFLGWKAVNAEGASGGIFICWDRRLL
# DMLDWEEGQFTLSCRFRNVENEIVWVFTGVYGPFSKVERDALWEEFGAIRGLWEDPWCIGGDFNITLFSSERSSQRRISSAMRKFAETVNDLGLVDLP
# LQGGDFTWNGGLNNQTWARLDRFLVSPSWIDQFSGINQCRLPRPVSDHFPIMLVGGGIRRGPTPFRFENMWLKAEGFKELVRSWWQGIDVRGSATLQQ
# LEFWDREENDRILTMEESELKKEAKENYRKWRIKINGEWFLEEQEIREGIANAFKELLSEDTEWKADIGSLQFDQISQEEAEILERPFTEEEIHGALM
# EMNGDKAPGPDGFTLAFWQSCWEFIKEEILEMFKEFYDHSSFLKSLNNTLLVLIPKKYGAENLGDFRPISLLGGLYKLLAKVLANRLKIVVGKVVSTS
# QNAFVRGRQILDASLIANEVIDSWQKRKEKGLICKLDIEKAYDSINWKFLLKVLQKMGFGSKWVRWMWSCLSSAKFSVMVNGVPAGFFPSSKGLRQGD
# PLSPYLFVMGMEVLDVLIRRAVEEGFLSGCNIRGGSEPPLNISHLLFAGDTIIFCEARKDHLTHLSWILFWFEAASGLRINLAKSEIIPVGEVVEMEE
# LAVELGCRVGSLPSQYLGLPLGVLNRAPYMWDGVEERVRRRLALWKRQYISKGGRVTLIKSTLSSMPIYQMSIFRMPKMVARRLEKVQRDFLWGRGNM
# EGKTHLVNWEVVCTDKDKGGLGIRKLAMLNKALLGKWIWRYACDKDNLWKQVIKVKYGLEDFGWRPKKARGAVGVGVWKEIWKESEWCWNNMIFKVGK
# GNTIRFWTDVWCSERALSHCFPHLFGMAVQRNSTVEEMWDQSSGQGNWNLNFLRDFNDWELELVGDFLQILRGHKPSWEENSVLWRKGRSGQFRVKEV
# YNLLARADDTGFPSRSIWVTRVPTKVCFFAWEATWGRILTLDRLQRRGLQLPNRCFLCGCEEESVNHILIHCTVVRALWDIVFGLVDVKWVFPETVKE
# VLVSWRGSFVGKKRKKTWDAIPLCIFWTVWKERNRLAFRGG]
# end gene g21
###
# start gene g22
NW_003724208.1	AUGUSTUS	gene	124426	129545	0.02	+	.	g22
NW_003724208.1	AUGUSTUS	transcript	124426	129545	0.01	+	.	g22.t1
NW_003724208.1	AUGUSTUS	tss	124426	124426	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	124426	124635	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	start_codon	124557	124559	.	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	initial	124557	124635	0.48	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	124969	125055	0.72	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	125271	125344	0.54	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	125671	125893	0.69	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	125980	126060	0.4	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	126261	126850	0.88	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	terminal	128465	128728	1	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	124636	124968	0.58	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125056	125270	0.5	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125345	125670	0.61	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125894	125979	0.41	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	126061	126260	0.4	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	126851	128464	0.11	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	124557	124635	0.48	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	124969	125055	0.72	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	124969	125055	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	125271	125344	0.54	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	125271	125344	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	125671	125893	0.69	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	125671	125893	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	125980	126060	0.4	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	125980	126060	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	126261	126850	0.88	+	2	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	126261	126850	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	128465	128728	1	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	128465	129545	.	+	.	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	stop_codon	128726	128728	.	+	0	transcript_id "g22.t1"; gene_id "g22";
NW_003724208.1	AUGUSTUS	tts	129545	129545	.	+	.	transcript_id "g22.t1"; gene_id "g22";
# coding sequence = [atgttggagggtcgcggcgtccagtcccagtccgcaccagccaccctcctcacagctactgtcgccgctgccgacggcg
# acttagccaaaaccctagatcaaagttgtggactagcagaagatatggagattccagaaggcaaccatagccgagatagttctatagagtcattcact
# gtggaaggaaatttactatgtaagggaatgacttatagcatgtacacttacattcttttcatggataaatttattgttgttggaagtccttccttcgt
# cagtaaggggcactcttttggggtgtcatggttcctttgtaggaaggaaacgttagaaggtttggagagtggccccactttgcattttttggacaatt
# tggaaggaagaaaccaaagagagttggacagtgaggagcagctggttcaagcattgaaacaatcactccgtagtaatcttttgtcttgggattgggtg
# ggttcttggtgggggaggaagtggttgttttttggttgtccaatccctttatggttgtgccttagtatcatctcatctgaggtggatcccatgcacct
# tcagtatttccgcttctctggtcgagtgattgcattagctttgatgcataaagtgcaagttggtgttgtctttgatcgagtatttttcttgcaattgg
# ctggaatggatatttccttggaagatatacaggatgcagatccattattgtatactagctgcaagcaaattctggatatggatgcagaattcatggat
# tcagatgctttgggactaacatttgttagagaaatcgaagaactaggatccagaagagttgtggagctttgccctggtgggaaaaacatcatcgtgaa
# cagcaagaacagggacgaatatgtttatcttcttattcggcatcgctttgttacatctacctctgaacaggtagcacaatttgctggaggctttgctg
# atattctttgtaaccaaaagctccagaagttctttttccagagtttagagcttgaagatcttgattggatgctatatggaagtgaaagtgctatttgt
# gttgatgactggaaggcacatactgagtacaacggctacaaggaaactgatcctcagattttctggttctggaagattattggcgaaatgtcagcaga
# gcagaggaagattctactcttcttttggacttcggttaagtatctacctgtagagggttttggtggtttggcttctcgtctatatatctacaagtcgt
# cagagccctgtgttcgcctgccttcatctcacacatgcttttaccggttgagtttcccaccttatccatcaatggctatcatggaagatcggcttcgc
# atcatcacccaagaacatgttggatgcagcttcggtacctggtga]
# protein sequence = [MLEGRGVQSQSAPATLLTATVAAADGDLAKTLDQSCGLAEDMEIPEGNHSRDSSIESFTVEGNLLCKGMTYSMYTYIL
# FMDKFIVVGSPSFVSKGHSFGVSWFLCRKETLEGLESGPTLHFLDNLEGRNQRELDSEEQLVQALKQSLRSNLLSWDWVGSWWGRKWLFFGCPIPLWL
# CLSIISSEVDPMHLQYFRFSGRVIALALMHKVQVGVVFDRVFFLQLAGMDISLEDIQDADPLLYTSCKQILDMDAEFMDSDALGLTFVREIEELGSRR
# VVELCPGGKNIIVNSKNRDEYVYLLIRHRFVTSTSEQVAQFAGGFADILCNQKLQKFFFQSLELEDLDWMLYGSESAICVDDWKAHTEYNGYKETDPQ
# IFWFWKIIGEMSAEQRKILLFFWTSVKYLPVEGFGGLASRLYIYKSSEPCVRLPSSHTCFYRLSFPPYPSMAIMEDRLRIITQEHVGCSFGTW]
NW_003724208.1	AUGUSTUS	transcript	124426	129545	0.01	+	.	g22.t2
NW_003724208.1	AUGUSTUS	tss	124426	124426	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	124426	124635	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	start_codon	124557	124559	.	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	initial	124557	124635	0.48	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	124969	125055	0.72	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	125271	125344	0.54	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	125671	125893	0.69	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	126261	126850	0.88	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	127111	127169	0.57	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	internal	128046	128100	0.16	+	1	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	terminal	128465	128728	1	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	124636	124968	0.58	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125056	125270	0.5	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125345	125670	0.61	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	125894	126260	0.39	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	126851	127110	0.66	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	127170	128045	0.09	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	intron	128101	128464	0.33	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	124557	124635	0.48	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	124969	125055	0.72	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	124969	125055	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	125271	125344	0.54	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	125271	125344	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	125671	125893	0.69	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	125671	125893	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	126261	126850	0.88	+	2	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	126261	126850	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	127111	127169	0.57	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	127111	127169	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	128046	128100	0.16	+	1	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	128046	128100	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	CDS	128465	128728	1	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	exon	128465	129545	.	+	.	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	stop_codon	128726	128728	.	+	0	transcript_id "g22.t2"; gene_id "g22";
NW_003724208.1	AUGUSTUS	tts	129545	129545	.	+	.	transcript_id "g22.t2"; gene_id "g22";
# coding sequence = [atgttggagggtcgcggcgtccagtcccagtccgcaccagccaccctcctcacagctactgtcgccgctgccgacggcg
# acttagccaaaaccctagatcaaagttgtggactagcagaagatatggagattccagaaggcaaccatagccgagatagttctatagagtcattcact
# gtggaaggaaatttactatgtaagggaatgacttatagcatgtacacttacattcttttcatggataaatttattgttgttggaagtccttccttcgt
# cagtaaggggcactcttttggggtgtcatggttcctttgtaggaaggaaacgttagaaggtttggagagtggccccactttgcattttttggacaatt
# tggaaggaagaaaccaaagagagttggacagtgaggagcagctggttcaagcattgaaacaatcactccgtagtaatcttttgtcttgggcatctgag
# gtggatcccatgcaccttcagtatttccgcttctctggtcgagtgattgcattagctttgatgcataaagtgcaagttggtgttgtctttgatcgagt
# atttttcttgcaattggctggaatggatatttccttggaagatatacaggatgcagatccattattgtatactagctgcaagcaaattctggatatgg
# atgcagaattcatggattcagatgctttgggactaacatttgttagagaaatcgaagaactaggatccagaagagttgtggagctttgccctggtggg
# aaaaacatcatcgtgaacagcaagaacagggacgaatatgtttatcttcttattcggcatcgctttgttacatctacctctgaacaggtagcacaatt
# tgctggaggctttgctgatattctttgtaaccaaaagctccagaagttctttttccagagtttagagcttgaagatcttgattggatgctatatggaa
# gtgaaagtgctatttgtgttgatgactggaaggcacatactgagtacaacggctacaaggaaactgatcctcagattttctggttctggaaggcaaac
# ctttcttacagtatggcatcactttatttgttgggtggcagcaccattggtcgatggttgattggatcaagcagggcaactgagtcttttgtgctact
# gtcatttgttattattggcgaaatgtcagcagagcagaggaagattctactcttcttttggacttcggttaagtatctacctgtagagggttttggtg
# gtttggcttctcgtctatatatctacaagtcgtcagagccctgtgttcgcctgccttcatctcacacatgcttttaccggttgagtttcccaccttat
# ccatcaatggctatcatggaagatcggcttcgcatcatcacccaagaacatgttggatgcagcttcggtacctggtga]
# protein sequence = [MLEGRGVQSQSAPATLLTATVAAADGDLAKTLDQSCGLAEDMEIPEGNHSRDSSIESFTVEGNLLCKGMTYSMYTYIL
# FMDKFIVVGSPSFVSKGHSFGVSWFLCRKETLEGLESGPTLHFLDNLEGRNQRELDSEEQLVQALKQSLRSNLLSWASEVDPMHLQYFRFSGRVIALA
# LMHKVQVGVVFDRVFFLQLAGMDISLEDIQDADPLLYTSCKQILDMDAEFMDSDALGLTFVREIEELGSRRVVELCPGGKNIIVNSKNRDEYVYLLIR
# HRFVTSTSEQVAQFAGGFADILCNQKLQKFFFQSLELEDLDWMLYGSESAICVDDWKAHTEYNGYKETDPQIFWFWKANLSYSMASLYLLGGSTIGRW
# LIGSSRATESFVLLSFVIIGEMSAEQRKILLFFWTSVKYLPVEGFGGLASRLYIYKSSEPCVRLPSSHTCFYRLSFPPYPSMAIMEDRLRIITQEHVG
# CSFGTW]
# end gene g22
###
# start gene g23
NW_003724208.1	AUGUSTUS	gene	130257	132101	0.03	-	.	g23
NW_003724208.1	AUGUSTUS	transcript	130257	132101	0.03	-	.	g23.t1
NW_003724208.1	AUGUSTUS	tts	130257	130257	.	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	exon	130257	131031	.	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	stop_codon	130693	130695	.	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	terminal	130693	131031	0.51	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	internal	131449	131574	0.37	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	initial	131785	131799	0.82	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	intron	131032	131448	0.32	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	intron	131575	131784	0.37	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	CDS	130693	131031	0.51	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	CDS	131449	131574	0.37	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	exon	131449	131574	.	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	CDS	131785	131799	0.82	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	exon	131785	132101	.	-	.	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	start_codon	131797	131799	.	-	0	transcript_id "g23.t1"; gene_id "g23";
NW_003724208.1	AUGUSTUS	tss	132101	132101	.	-	.	transcript_id "g23.t1"; gene_id "g23";
# coding sequence = [atggccactgttgagaagcagaatccatcattttgtgatcacccagttttagaatatgcaaaactggagtgcatggcac
# agtatgaatggatcaatattatgatcatcatggagcttgatcaaatattgatccagaaaaaaagccagttactgaagaaacaaaggaagagggcttcc
# agtggaggaggcagcggcactgaagctgaagccaaagctgaagctcctgttgaagttgaagttgagacaaaggaggttgtagaggaagccgcggttga
# ggaggcagaagcagagaaaaccgaaggagagactccagcagtggaggcagaagccgctgttgagaaggccaaagaagagactactgaggaggcagctg
# cagccccagcagaggaagctgccgccaaggaagaagaagaagccaaaccagctgaagcagcagaggaagccagcacagaggttcctgtcgagaagatt
# gaggaatag]
# protein sequence = [MATVEKQNPSFCDHPVLEYAKLECMAQYEWINIMIIMELDQILIQKKSQLLKKQRKRASSGGGSGTEAEAKAEAPVEV
# EVETKEVVEEAAVEEAEAEKTEGETPAVEAEAAVEKAKEETTEEAAAAPAEEAAAKEEEEAKPAEAAEEASTEVPVEKIEE]
# end gene g23
###
# start gene g24
NW_003724208.1	AUGUSTUS	gene	136086	137351	0.02	-	.	g24
NW_003724208.1	AUGUSTUS	transcript	136086	137351	0.02	-	.	g24.t1
NW_003724208.1	AUGUSTUS	tts	136086	136086	.	-	.	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	exon	136086	137137	.	-	.	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	stop_codon	136788	136790	.	-	0	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	terminal	136788	137137	0.38	-	2	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	initial	137212	137290	0.6	-	0	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	intron	137138	137211	0.39	-	.	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	CDS	136788	137137	0.38	-	2	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	CDS	137212	137290	0.6	-	0	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	exon	137212	137351	.	-	.	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	start_codon	137288	137290	.	-	0	transcript_id "g24.t1"; gene_id "g24";
NW_003724208.1	AUGUSTUS	tss	137351	137351	.	-	.	transcript_id "g24.t1"; gene_id "g24";
# coding sequence = [atgttcttacaagtctatattaagaatctaagatcaaggaagctgtcttctgcactgccttcttgcccttccatacaag
# gtgcttcatgtcttgcacacctaggcatgacaatgaaagtcagatgtcttgaaggttatggttattctgcattcataagtgtctcaaatgccaaaaag
# atggaatcatcctgtgttgcccatttgccagtggtggggcaagcaggcaatgatgagtcacttgagctaggcaatggttgccatttcggttattactt
# ggcagatcaaggcttattctctctcatgcctcaaccaatggctaaaagggatgaaagcaagtttacatcaaagctaatgtttatgaaaggatgtttct
# cttttagaagtgacaacaaaaaccccatcatgccatctgatattcttctagtataa]
# protein sequence = [MFLQVYIKNLRSRKLSSALPSCPSIQGASCLAHLGMTMKVRCLEGYGYSAFISVSNAKKMESSCVAHLPVVGQAGNDE
# SLELGNGCHFGYYLADQGLFSLMPQPMAKRDESKFTSKLMFMKGCFSFRSDNKNPIMPSDILLV]
# end gene g24
###
# start gene g25
NW_003724208.1	AUGUSTUS	gene	138766	139659	0.01	+	.	g25
NW_003724208.1	AUGUSTUS	transcript	138766	139659	0.01	+	.	g25.t1
NW_003724208.1	AUGUSTUS	tss	138766	138766	.	+	.	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	exon	138766	139232	.	+	.	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	start_codon	138816	138818	.	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	initial	138816	139232	0.59	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	terminal	139386	139472	0.33	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	intron	139233	139385	0.34	+	.	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	CDS	138816	139232	0.59	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	CDS	139386	139472	0.33	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	exon	139386	139659	.	+	.	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	stop_codon	139470	139472	.	+	0	transcript_id "g25.t1"; gene_id "g25";
NW_003724208.1	AUGUSTUS	tts	139659	139659	.	+	.	transcript_id "g25.t1"; gene_id "g25";
# coding sequence = [atgcagcattttccaatcttacccctttccttcacggtgggcaatgggagaaggattaaattttggaaagacaaatggt
# gtggtgatgagcttttgtgtgtcttgttcccctccttatttgccctagctagctgtaaagaggcttgggtggcggacttgtggatgtactctaataag
# aagggtgtttggattcctaatttctctagacctctcaatgactgggatattgagactgtggagtgctttttttcaaggcttcaagataaggcggtgga
# tgtggaaggggaggacaagatgttttgggtggcaacaaagagtgaatccttctctattaagtccctctactctatccttgaggcaggaaaggtggagc
# cttttccttcaagtgtagtgtggaatgcatgggttcctccaaagggtgttgtaggagctcttgttatctgttttaagggtgtcttgggtgatccattc
# tacaataagagagacccttttagggtggcatga]
# protein sequence = [MQHFPILPLSFTVGNGRRIKFWKDKWCGDELLCVLFPSLFALASCKEAWVADLWMYSNKKGVWIPNFSRPLNDWDIET
# VECFFSRLQDKAVDVEGEDKMFWVATKSESFSIKSLYSILEAGKVEPFPSSVVWNAWVPPKGVVGALVICFKGVLGDPFYNKRDPFRVA]
# end gene g25
###
# start gene g26
NW_003724208.1	AUGUSTUS	gene	139852	143461	0.06	-	.	g26
NW_003724208.1	AUGUSTUS	transcript	139852	143461	0.05	-	.	g26.t1
NW_003724208.1	AUGUSTUS	tts	139852	139852	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	139852	140253	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	stop_codon	140236	140238	.	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	terminal	140236	140253	0.68	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140333	140391	0.75	-	2	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140571	140632	0.88	-	1	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140761	140860	0.58	-	2	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	141298	141346	0.91	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	141437	141556	0.93	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	142962	143055	0.89	-	1	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	initial	143143	143294	0.99	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140254	140332	0.69	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140392	140570	0.79	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140633	140760	0.59	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140861	141297	0.91	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	141347	141436	0.93	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	141557	142961	0.27	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	143056	143142	0.99	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140236	140253	0.68	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140333	140391	0.75	-	2	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140333	140391	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140571	140632	0.88	-	1	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140571	140632	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140761	140860	0.58	-	2	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140761	140860	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	141298	141346	0.91	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	141298	141346	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	141437	141556	0.93	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	141437	141556	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	142962	143055	0.89	-	1	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	142962	143055	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	143143	143294	0.99	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	143143	143461	.	-	.	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	start_codon	143292	143294	.	-	0	transcript_id "g26.t1"; gene_id "g26";
NW_003724208.1	AUGUSTUS	tss	143461	143461	.	-	.	transcript_id "g26.t1"; gene_id "g26";
# coding sequence = [atggcggaagatctggtgttggacacggccatcagagattgggtgcttataccactgtcggtggtgatggttctcatcg
# gggtgctccgctatttcgtctccaagctcatgcgatcctctcaagtgcccgattccaaaatcgttagagaagggcaggtgattgttagggctcgaaac
# ttgcgggcggcggcgaattacattccggccaagtcgtttcgtgctaggaaagtttacttcaataacgaggaaaatggattactgcatgttcctaaggg
# tcaggcgcaaaatgctcaggcacaaatgttctctgatccaaacatggctatggatatgatgaagaagaacctttcaatgatcattccccagactctta
# cttttgcttgggttaactttttcttctctggatttgtagcagccaagatacctttccccttgactcagaggtttcgctccatgttacaaaatggaatt
# gatttgagcactgtagatgttagctatgtcagcagtcgctcatggtacttcctcaacctgttcggattaaggggtttatttagtctcattctgggaga
# agaaaatgccacagatgatacccagcgtatgatgcaaatgagtgggttcggcgttgatcctacaaagcactgcacaagtatgtga]
# protein sequence = [MAEDLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDSKIVREGQVIVRARNLRAAANYIPAKSFRARKVY
# FNNEENGLLHVPKGQAQNAQAQMFSDPNMAMDMMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN
# LFGLRGLFSLILGEENATDDTQRMMQMSGFGVDPTKHCTSM]
NW_003724208.1	AUGUSTUS	transcript	139852	143461	0.01	-	.	g26.t2
NW_003724208.1	AUGUSTUS	tts	139852	139852	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	139852	140253	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	stop_codon	140236	140238	.	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	terminal	140236	140253	0.68	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140333	140391	0.75	-	2	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140571	140632	0.88	-	1	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	140716	140860	0.32	-	2	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	141298	141346	0.91	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	141437	141556	0.93	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	internal	142962	143055	0.89	-	1	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	initial	143143	143294	0.99	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140254	140332	0.69	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140392	140570	0.79	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140633	140715	0.32	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	140861	141297	0.91	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	141347	141436	0.93	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	141557	142961	0.27	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	intron	143056	143142	0.99	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140236	140253	0.68	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140333	140391	0.75	-	2	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140333	140391	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140571	140632	0.88	-	1	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140571	140632	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	140716	140860	0.32	-	2	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	140716	140860	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	141298	141346	0.91	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	141298	141346	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	141437	141556	0.93	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	141437	141556	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	142962	143055	0.89	-	1	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	142962	143055	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	CDS	143143	143294	0.99	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	exon	143143	143461	.	-	.	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	start_codon	143292	143294	.	-	0	transcript_id "g26.t2"; gene_id "g26";
NW_003724208.1	AUGUSTUS	tss	143461	143461	.	-	.	transcript_id "g26.t2"; gene_id "g26";
# coding sequence = [atggcggaagatctggtgttggacacggccatcagagattgggtgcttataccactgtcggtggtgatggttctcatcg
# gggtgctccgctatttcgtctccaagctcatgcgatcctctcaagtgcccgattccaaaatcgttagagaagggcaggtgattgttagggctcgaaac
# ttgcgggcggcggcgaattacattccggccaagtcgtttcgtgctaggaaagtttacttcaataacgaggaaaatggattactgcatgttcctaaggg
# tcaggcgcaaaatgctcaggcacaaatgttctctgatccaaacatggctatggatatgatgaagaagaacctttcaatgatcattccccagactctta
# cttttgcttgggttaactttttcttctctggatttgtagcagccaagatacctttccccttgactcagaggtttcgctccatgttacaaaatggaatt
# gatttgagcactgtagatgttagctatgtcagcagtcgctcatggtacttgcttaatatcaagaacaagaaagctattacttccagcctgtacttcct
# caacctgttcggattaaggggtttatttagtctcattctgggagaagaaaatgccacagatgatacccagcgtatgatgcaaatgagtgggttcggcg
# ttgatcctacaaagcactgcacaagtatgtga]
# protein sequence = [MAEDLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDSKIVREGQVIVRARNLRAAANYIPAKSFRARKVY
# FNNEENGLLHVPKGQAQNAQAQMFSDPNMAMDMMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYLLN
# IKNKKAITSSLYFLNLFGLRGLFSLILGEENATDDTQRMMQMSGFGVDPTKHCTSM]
# end gene g26
###
# start gene g27
NW_003724208.1	AUGUSTUS	gene	145286	147775	0.27	+	.	g27
NW_003724208.1	AUGUSTUS	transcript	145286	147775	0.16	+	.	g27.t1
NW_003724208.1	AUGUSTUS	tss	145286	145286	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	145286	145761	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	start_codon	145348	145350	.	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	initial	145348	145761	0.99	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	145906	146017	1	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	146101	146182	0.98	+	2	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	147436	147487	0.98	+	1	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	terminal	147569	147712	0.49	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	145762	145905	1	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	146018	146100	1	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	146183	147435	0.98	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	147488	147568	0.57	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	145348	145761	0.99	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	145906	146017	1	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	145906	146017	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	146101	146182	0.98	+	2	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	146101	146182	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	147436	147487	0.98	+	1	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	147436	147487	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	147569	147712	0.49	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	147569	147775	.	+	.	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	stop_codon	147710	147712	.	+	0	transcript_id "g27.t1"; gene_id "g27";
NW_003724208.1	AUGUSTUS	tts	147775	147775	.	+	.	transcript_id "g27.t1"; gene_id "g27";
# coding sequence = [atgggcttaatctccttccccaccaatgtattctgccgcagaccactgtcgatctctcctccattgcgaaccaaatcaa
# gttgttcgtacaatccttggcttaatctgaagtccattctgaagagacagcctcaaagagctcaagttttcaatgatcctcttctgtcattgtcgaac
# caggctgtggttcagaggggcttgtctttaaggcgcaaacgcttaccgccggtagtgtcgtgcagttctgaaagcacagggccaagggaagaagataa
# cagagctctggaagcagtccagaagctttacactgctattaagaacaaaaatgtgaaggaagtctcagatgtaattggagatgaatgccgatgtttct
# gcaattttatctcagcgtcccaacccttccatggaaagaagcaagcgttggaatttttcgatcatctgatgaaaatcttgggagatcatgcttcaatc
# aaattttcctttacaatgcatgatgggatggccgttggagttacatggagactagaatggaaaaacaatccggtgcctctgggaactggtttcagcta
# ctacgtgtgccaagaataccgagggagggtggtgataaagaacgttaatatgcttatggacccgctgattcaccttggacccctgaggctgagaattg
# cggggatagtgacgctcgtaatggacaagtttgggcacttaaccttcgagggtaagagaaagaaagatatatacatgtttctcattctctccttcacc
# tttgccatactgttctttctaataacggcttcccattaa]
# protein sequence = [MGLISFPTNVFCRRPLSISPPLRTKSSCSYNPWLNLKSILKRQPQRAQVFNDPLLSLSNQAVVQRGLSLRRKRLPPVV
# SCSSESTGPREEDNRALEAVQKLYTAIKNKNVKEVSDVIGDECRCFCNFISASQPFHGKKQALEFFDHLMKILGDHASIKFSFTMHDGMAVGVTWRLE
# WKNNPVPLGTGFSYYVCQEYRGRVVIKNVNMLMDPLIHLGPLRLRIAGIVTLVMDKFGHLTFEGKRKKDIYMFLILSFTFAILFFLITASH]
NW_003724208.1	AUGUSTUS	transcript	145286	147775	0.11	+	.	g27.t2
NW_003724208.1	AUGUSTUS	tss	145286	145286	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	145286	145761	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	start_codon	145348	145350	.	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	initial	145348	145761	0.99	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	145906	146017	1	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	146101	146182	0.98	+	2	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	internal	147436	147487	0.98	+	1	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	terminal	147571	147630	0.41	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	145762	145905	1	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	146018	146100	1	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	146183	147435	0.98	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	intron	147488	147570	0.41	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	145348	145761	0.99	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	145906	146017	1	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	145906	146017	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	146101	146182	0.98	+	2	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	146101	146182	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	147436	147487	0.98	+	1	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	147436	147487	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	CDS	147571	147630	0.41	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	exon	147571	147775	.	+	.	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	stop_codon	147628	147630	.	+	0	transcript_id "g27.t2"; gene_id "g27";
NW_003724208.1	AUGUSTUS	tts	147775	147775	.	+	.	transcript_id "g27.t2"; gene_id "g27";
# coding sequence = [atgggcttaatctccttccccaccaatgtattctgccgcagaccactgtcgatctctcctccattgcgaaccaaatcaa
# gttgttcgtacaatccttggcttaatctgaagtccattctgaagagacagcctcaaagagctcaagttttcaatgatcctcttctgtcattgtcgaac
# caggctgtggttcagaggggcttgtctttaaggcgcaaacgcttaccgccggtagtgtcgtgcagttctgaaagcacagggccaagggaagaagataa
# cagagctctggaagcagtccagaagctttacactgctattaagaacaaaaatgtgaaggaagtctcagatgtaattggagatgaatgccgatgtttct
# gcaattttatctcagcgtcccaacccttccatggaaagaagcaagcgttggaatttttcgatcatctgatgaaaatcttgggagatcatgcttcaatc
# aaattttcctttacaatgcatgatgggatggccgttggagttacatggagactagaatggaaaaacaatccggtgcctctgggaactggtttcagcta
# ctacgtgtgccaagaataccgagggagggtggtgataaagaacgttaatatgcttatggacccgctgattcaccttggacccctgaggctgaattgcg
# gggatagtgacgctcgtaatggacaagtttgggcacttaaccttcgagggtaa]
# protein sequence = [MGLISFPTNVFCRRPLSISPPLRTKSSCSYNPWLNLKSILKRQPQRAQVFNDPLLSLSNQAVVQRGLSLRRKRLPPVV
# SCSSESTGPREEDNRALEAVQKLYTAIKNKNVKEVSDVIGDECRCFCNFISASQPFHGKKQALEFFDHLMKILGDHASIKFSFTMHDGMAVGVTWRLE
# WKNNPVPLGTGFSYYVCQEYRGRVVIKNVNMLMDPLIHLGPLRLNCGDSDARNGQVWALNLRG]
# end gene g27
###
# start gene g28
NW_003724208.1	AUGUSTUS	gene	147808	148401	0.85	-	.	g28
NW_003724208.1	AUGUSTUS	transcript	147808	148401	0.42	-	.	g28.t1
NW_003724208.1	AUGUSTUS	tts	147808	147808	.	-	.	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	exon	147808	148401	.	-	.	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	stop_codon	147971	147973	.	-	0	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	single	147971	148372	0.47	-	0	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	CDS	147971	148372	0.47	-	0	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	start_codon	148370	148372	.	-	0	transcript_id "g28.t1"; gene_id "g28";
NW_003724208.1	AUGUSTUS	tss	148401	148401	.	-	.	transcript_id "g28.t1"; gene_id "g28";
# coding sequence = [atggctaggactactgacattggttttgtgctgggggtgatagtggtagtgcttgttgcagtggtgggtggagccaagt
# ccatgaccatatgcagcatggactcaacccagctggctcagtgcctccctgcaattcgaggcccatcaccatcccctcctactaaagagtgttgtgca
# gtcatccaaaaggccgatatgcactgcttgtgcagctacaagcatgccctccccaactttggcgtcaaccctggacttgccatggccttgcccaagaa
# gtgtggcctcaacccaccacccgaatgtgacggtaagcctcctagccctgcatctaccatatcaagaacgataaccatatcatatcaagaatgctcat
# ttctcagttcttgctctgcaggtccttga]
# protein sequence = [MARTTDIGFVLGVIVVVLVAVVGGAKSMTICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHALPN
# FGVNPGLAMALPKKCGLNPPPECDGKPPSPASTISRTITISYQECSFLSSCSAGP]
NW_003724208.1	AUGUSTUS	transcript	147808	148401	0.43	-	.	g28.t2
NW_003724208.1	AUGUSTUS	tts	147808	147808	.	-	.	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	exon	147808	147978	.	-	.	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	stop_codon	147971	147973	.	-	0	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	terminal	147971	147978	0.51	-	2	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	initial	148066	148372	0.53	-	0	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	intron	147979	148065	0.51	-	.	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	CDS	147971	147978	0.51	-	2	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	CDS	148066	148372	0.53	-	0	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	exon	148066	148401	.	-	.	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	start_codon	148370	148372	.	-	0	transcript_id "g28.t2"; gene_id "g28";
NW_003724208.1	AUGUSTUS	tss	148401	148401	.	-	.	transcript_id "g28.t2"; gene_id "g28";
# coding sequence = [atggctaggactactgacattggttttgtgctgggggtgatagtggtagtgcttgttgcagtggtgggtggagccaagt
# ccatgaccatatgcagcatggactcaacccagctggctcagtgcctccctgcaattcgaggcccatcaccatcccctcctactaaagagtgttgtgca
# gtcatccaaaaggccgatatgcactgcttgtgcagctacaagcatgccctccccaactttggcgtcaaccctggacttgccatggccttgcccaagaa
# gtgtggcctcaacccaccacccgaatgtgacggtccttga]
# protein sequence = [MARTTDIGFVLGVIVVVLVAVVGGAKSMTICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHALPN
# FGVNPGLAMALPKKCGLNPPPECDGP]
# end gene g28
###
# start gene g29
NW_003724208.1	AUGUSTUS	gene	151131	154391	0.03	-	.	g29
NW_003724208.1	AUGUSTUS	transcript	151131	154391	0.03	-	.	g29.t1
NW_003724208.1	AUGUSTUS	tts	151131	151131	.	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	exon	151131	152275	.	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	stop_codon	152049	152051	.	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	terminal	152049	152275	0.43	-	2	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	internal	152364	152535	1	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	internal	152650	152761	0.89	-	1	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	initial	153690	154135	0.93	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	intron	152276	152363	1	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	intron	152536	152649	0.89	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	intron	152762	153689	0.95	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	CDS	152049	152275	0.43	-	2	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	CDS	152364	152535	1	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	exon	152364	152535	.	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	CDS	152650	152761	0.89	-	1	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	exon	152650	152761	.	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	CDS	153690	154135	0.93	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	exon	153690	154391	.	-	.	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	start_codon	154133	154135	.	-	0	transcript_id "g29.t1"; gene_id "g29";
NW_003724208.1	AUGUSTUS	tss	154391	154391	.	-	.	transcript_id "g29.t1"; gene_id "g29";
# coding sequence = [atggtgtcggatcaagatatcgcgaaaggtgtggagacactgctccgtcagtctgagcccaactcattcacctccttaa
# acggcatcgttaagcagctggaagccaaactagggctcgacctgtcccataaggctgtcttcatcagagaccagatcagtttcctgctccggtctcac
# cctcagccccttcccccaaaagaccattttgccctccagcaacacccccaattcctcagtccccacccccaaatcccttcccattttgcccttcagca
# ccaccgcccaccgccggaagacctcaacttcctgtaccccctcccccagcctcagccgcagacgcagacgcagccgcagccgcagccgcagacgcagc
# cgcatcacctgccgaaaggtgaagcctttctgcagaatgcagctagtgtcgccgcccaagcgcccaaagaaagtgctccagctgcagccaaaagaaga
# ggtggctcggggggtctaaacaaagtctgtggggtttcaactgaacttcaggctgttgttggcgagccaaccatgccaaggacacagattgtgaagca
# gctttgggcatacattaggaaaaacaacctccaagatcctagtaacaagcgaaagataatttgtgatgatgccctccgcttggtgtttgagacagatt
# ctactgatatgttcaagatgaataagttgcttgctaaacatatcattccgcttgaaccttcaagagaatccagtcaagctaaacggttgaaggtggat
# gttgagtctgcaactgaaagtagtgaagccagtccatctcctgtaatgatatctgatgcacttgccacgttttttggtactggagaaagggagatgct
# ccaagaagaggccctaaggcgtgtttgggagtacataaaggtcaaccaattagaggtgggtataaggtgcacatgtcgtgcctttcttacttga]
# protein sequence = [MVSDQDIAKGVETLLRQSEPNSFTSLNGIVKQLEAKLGLDLSHKAVFIRDQISFLLRSHPQPLPPKDHFALQQHPQFL
# SPHPQIPSHFALQHHRPPPEDLNFLYPLPQPQPQTQTQPQPQPQTQPHHLPKGEAFLQNAASVAAQAPKESAPAAAKRRGGSGGLNKVCGVSTELQAV
# VGEPTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLEPSRESSQAKRLKVDVESATESSEASPSPVMISD
# ALATFFGTGEREMLQEEALRRVWEYIKVNQLEVGIRCTCRAFLT]
# end gene g29
###
# start gene g30
NW_003724208.1	AUGUSTUS	gene	156586	160578	0.05	+	.	g30
NW_003724208.1	AUGUSTUS	transcript	157556	160578	0.02	+	.	g30.t1
NW_003724208.1	AUGUSTUS	tss	157556	157556	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	157556	157683	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	159040	159107	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	start_codon	159064	159066	.	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	initial	159064	159107	0.41	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	internal	159202	159238	0.64	+	1	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	internal	159779	160000	1	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	terminal	160084	160305	0.91	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	intron	159108	159201	0.41	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	intron	159239	159778	0.64	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	intron	160001	160083	0.91	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	159064	159107	0.41	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	159202	159238	0.64	+	1	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	159202	159238	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	159779	160000	1	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	159779	160000	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	160084	160305	0.91	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	160084	160578	.	+	.	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	stop_codon	160303	160305	.	+	0	transcript_id "g30.t1"; gene_id "g30";
NW_003724208.1	AUGUSTUS	tts	160578	160578	.	+	.	transcript_id "g30.t1"; gene_id "g30";
# coding sequence = [atgccatgtggaagaaaggaatcaaaatacccacaagagttttgccatgccctgaataatatgcttgagatccttccca
# aggaagaagcaaggaaagcactagaaagtgcacttgggggaaagaaagatgaatttgaaaaatggaacaaagaaattaagaagagagaggaggtgggg
# ggaggcggtgaggctggtggaggaggttggtttggatggggtggacgttttggttggtccaatgatgatcatttctggcaagaggcacaacaagcaag
# ccttgccatcttgggtatcattatcatgtatctcataattgcaaaaggcgaagtgttgcttgctgtcatcttcaatccattgctgtttgctttgcgag
# gaacgagaaatgggtttaacttcataatctcgcgtatactgcagaaggtatctccagctactcatacagggcttgataatatgccaaaaaaggaagtc
# tatactcctgtctctgccaaagagagtgtagttagaaaatggggaggggaataa]
# protein sequence = [MPCGRKESKYPQEFCHALNNMLEILPKEEARKALESALGGKKDEFEKWNKEIKKREEVGGGGEAGGGGWFGWGGRFGW
# SNDDHFWQEAQQASLAILGIIIMYLIIAKGEVLLAVIFNPLLFALRGTRNGFNFIISRILQKVSPATHTGLDNMPKKEVYTPVSAKESVVRKWGGE]
NW_003724208.1	AUGUSTUS	transcript	156586	160578	0.03	+	.	g30.t2
NW_003724208.1	AUGUSTUS	tss	156586	156586	.	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	156586	156634	.	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	157433	157683	.	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	start_codon	157501	157503	.	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	initial	157501	157683	0.38	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	internal	159779	160000	1	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	terminal	160084	160305	0.91	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	intron	157684	159778	0.23	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	intron	160001	160083	0.91	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	157501	157683	0.38	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	159779	160000	1	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	159779	160000	.	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	CDS	160084	160305	0.91	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	exon	160084	160578	.	+	.	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	stop_codon	160303	160305	.	+	0	transcript_id "g30.t2"; gene_id "g30";
NW_003724208.1	AUGUSTUS	tts	160578	160578	.	+	.	transcript_id "g30.t2"; gene_id "g30";
# coding sequence = [atggcgcagcttcttaccctacgccctccaatcacagcctttcgatctgcgccatccacgcgcactgattcagctgttt
# tatcgtgttgccctaaaaccctaaaccccaaatgggcctttctgcagcagaagctcaagtgcaatggcagattttcttgccttttctcaaacaatcgc
# aagcaggaagaagcaaggaaagcactagaaagtgcacttgggggaaagaaagatgaatttgaaaaatggaacaaagaaattaagaagagagaggaggt
# ggggggaggcggtgaggctggtggaggaggttggtttggatggggtggacgttttggttggtccaatgatgatcatttctggcaagaggcacaacaag
# caagccttgccatcttgggtatcattatcatgtatctcataattgcaaaaggcgaagtgttgcttgctgtcatcttcaatccattgctgtttgctttg
# cgaggaacgagaaatgggtttaacttcataatctcgcgtatactgcagaaggtatctccagctactcatacagggcttgataatatgccaaaaaagga
# agtctatactcctgtctctgccaaagagagtgtagttagaaaatggggaggggaataa]
# protein sequence = [MAQLLTLRPPITAFRSAPSTRTDSAVLSCCPKTLNPKWAFLQQKLKCNGRFSCLFSNNRKQEEARKALESALGGKKDE
# FEKWNKEIKKREEVGGGGEAGGGGWFGWGGRFGWSNDDHFWQEAQQASLAILGIIIMYLIIAKGEVLLAVIFNPLLFALRGTRNGFNFIISRILQKVS
# PATHTGLDNMPKKEVYTPVSAKESVVRKWGGE]
# end gene g30
###
# start gene g31
NW_003724208.1	AUGUSTUS	gene	162506	165638	0.06	+	.	g31
NW_003724208.1	AUGUSTUS	transcript	162506	165638	0.06	+	.	g31.t1
NW_003724208.1	AUGUSTUS	tss	162506	162506	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	exon	162506	163116	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	start_codon	162865	162867	.	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	initial	162865	163116	0.54	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	internal	163218	163284	0.98	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	internal	163985	164203	0.94	+	2	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	internal	164301	164425	1	+	2	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	terminal	164901	164975	0.99	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	intron	163117	163217	0.98	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	intron	163285	163984	0.94	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	intron	164204	164300	1	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	intron	164426	164900	0.93	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	CDS	162865	163116	0.54	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	CDS	163218	163284	0.98	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	exon	163218	163284	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	CDS	163985	164203	0.94	+	2	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	exon	163985	164203	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	CDS	164301	164425	1	+	2	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	exon	164301	164425	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	CDS	164901	164975	0.99	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	exon	164901	165638	.	+	.	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	stop_codon	164973	164975	.	+	0	transcript_id "g31.t1"; gene_id "g31";
NW_003724208.1	AUGUSTUS	tts	165638	165638	.	+	.	transcript_id "g31.t1"; gene_id "g31";
# coding sequence = [atgtctctggctgttggggtggtttccagttccaaaagcatgggttttgacaacaatgagggtgcagcaaacactgatc
# tttcagagactaagagcacagcaaagactcctgcagatgaagagagaggtgatgaacatggagggtgtgagaattctgtggatgcaactgaggaagag
# gaagaggaagatgaagagaggaagatagagttgggtcctcagttcactctcaaagaacaacttgagaaagataaggatgatgagagcttgaggaggtg
# gaaggaacagcttcttggcagtgtggatttgaattctgttggagaaactctagaaccagatgttaagatcctggaacttgcaataaagtcccctggta
# gacctgacattgttcttccaatccccgaatcgggaaatcctaagggcttgtggtttactttgaaagaaggcagtcgttacagcatgaacttcgctttc
# aaagtcagtaataacattgtatcaggcctcagatgcaccaatgttgtttggaaaacaggactcaaggtggacagcacaaaagagatgcttggaacctt
# cagtcctcagcaggagacttacactcatgagatgcctgaagagacgaccccatctgggatctttgctagaggaacttactcagctaaaaccaagtttc
# ttgatgacgataacaagtgctacttggagatcaactacagcttcgacatcaggaaagattggcagtcatga]
# protein sequence = [MSLAVGVVSSSKSMGFDNNEGAANTDLSETKSTAKTPADEERGDEHGGCENSVDATEEEEEEDEERKIELGPQFTLKE
# QLEKDKDDESLRRWKEQLLGSVDLNSVGETLEPDVKILELAIKSPGRPDIVLPIPESGNPKGLWFTLKEGSRYSMNFAFKVSNNIVSGLRCTNVVWKT
# GLKVDSTKEMLGTFSPQQETYTHEMPEETTPSGIFARGTYSAKTKFLDDDNKCYLEINYSFDIRKDWQS]
# end gene g31
###
# start gene g32
NW_003724208.1	AUGUSTUS	gene	172306	180373	0.09	-	.	g32
NW_003724208.1	AUGUSTUS	transcript	176768	180373	0.05	-	.	g32.t1
NW_003724208.1	AUGUSTUS	tts	176768	176768	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	176768	177169	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	stop_codon	177152	177154	.	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	terminal	177152	177169	0.68	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177249	177307	0.84	-	2	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177487	177548	0.93	-	1	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177677	177776	0.97	-	2	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178217	178265	1	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178357	178476	0.99	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	179883	179976	0.84	-	1	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	initial	180064	180215	0.99	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177170	177248	0.68	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177308	177486	0.84	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177549	177676	0.97	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177777	178216	1	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178266	178356	1	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178477	179882	0.18	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	179977	180063	0.99	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177152	177169	0.68	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177249	177307	0.84	-	2	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177249	177307	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177487	177548	0.93	-	1	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177487	177548	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177677	177776	0.97	-	2	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177677	177776	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178217	178265	1	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178217	178265	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178357	178476	0.99	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178357	178476	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	179883	179976	0.84	-	1	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	179883	179976	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	180064	180215	0.99	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	180064	180373	.	-	.	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	start_codon	180213	180215	.	-	0	transcript_id "g32.t1"; gene_id "g32";
NW_003724208.1	AUGUSTUS	tss	180373	180373	.	-	.	transcript_id "g32.t1"; gene_id "g32";
# coding sequence = [atggcggaagatctggtgctggacacggccatcagagattgggtgcttataccactgtcggtggtgatggttctcatcg
# gggtgctccgctatttcgtctccaagctcatgcgatcctctcaagtgcccgattccaaaatcgttagagaagggcaggtgattgttagggctcgaaac
# ttgcgggcggcggcgaattacattccggccaaatcgtttcgtgctaggaaagtttacttcaataacgaggaaaatggattactgcatgttcctaaggg
# tcaggcgcaaaatgctcaggcacaaatgttctctgatccaaacatggctatggatatgatgaagaagaacctttcaatgatcataccccagactctta
# cttttgcttgggttaactttttcttctctggatttgtagcagccaagatacctttccccttgactcagaggtttcgctccatgttacaaaatggaatt
# gatttgagcactgtagatgttagctatgtcagcagtcgctcatggtacttcctcaacctgttcggattaaggggtttatttagtctcattctgggaga
# agaaaatgccacagatgatacccagcgtatgatgcaaatgagtgggttcggcgttgatcctacaaagcactgcacaagtatgtga]
# protein sequence = [MAEDLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDSKIVREGQVIVRARNLRAAANYIPAKSFRARKVY
# FNNEENGLLHVPKGQAQNAQAQMFSDPNMAMDMMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN
# LFGLRGLFSLILGEENATDDTQRMMQMSGFGVDPTKHCTSM]
NW_003724208.1	AUGUSTUS	transcript	176768	180373	0.03	-	.	g32.t2
NW_003724208.1	AUGUSTUS	tts	176768	176768	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	176768	177169	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	stop_codon	177152	177154	.	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	terminal	177152	177169	0.68	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177249	177307	0.84	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177487	177548	0.93	-	1	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177677	177776	0.97	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178217	178265	1	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178357	178476	0.99	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178576	178637	0.63	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	179308	179443	0.27	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	179883	179976	0.84	-	1	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	initial	180064	180215	0.99	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177170	177248	0.68	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177308	177486	0.84	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177549	177676	0.97	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177777	178216	1	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178266	178356	1	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178477	178575	0.63	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178638	179307	0.34	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	179444	179882	0.23	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	179977	180063	0.99	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177152	177169	0.68	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177249	177307	0.84	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177249	177307	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177487	177548	0.93	-	1	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177487	177548	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177677	177776	0.97	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177677	177776	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178217	178265	1	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178217	178265	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178357	178476	0.99	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178357	178476	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178576	178637	0.63	-	2	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178576	178637	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	179308	179443	0.27	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	179308	179443	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	179883	179976	0.84	-	1	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	179883	179976	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	180064	180215	0.99	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	180064	180373	.	-	.	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	start_codon	180213	180215	.	-	0	transcript_id "g32.t2"; gene_id "g32";
NW_003724208.1	AUGUSTUS	tss	180373	180373	.	-	.	transcript_id "g32.t2"; gene_id "g32";
# coding sequence = [atggcggaagatctggtgctggacacggccatcagagattgggtgcttataccactgtcggtggtgatggttctcatcg
# gggtgctccgctatttcgtctccaagctcatgcgatcctctcaagtgcccgattccaaaatcgttagagaagggcaggtgattgttagggctcgaaac
# ttgcgggcggcggcgaattacattccggccaaatcgtttcgtgctaggaaagtttacttcaataacgagatatgtgcttctgagaatgaccataacaa
# agcagacattactcacagaactagaacaggatggatgaagtggagagttgctcctagcatgttgtgggttgaatccatgcttcccaatttgaacggaa
# aattatgtgtgtatcttttggctggctttgctttatgggctgcctcaattgtaataactcatagaagccaggaaaatggattactgcatgttcctaag
# ggtcaggcgcaaaatgctcaggcacaaatgttctctgatccaaacatggctatggatatgatgaagaagaacctttcaatgatcataccccagactct
# tacttttgcttgggttaactttttcttctctggatttgtagcagccaagatacctttccccttgactcagaggtttcgctccatgttacaaaatggaa
# ttgatttgagcactgtagatgttagctatgtcagcagtcgctcatggtacttcctcaacctgttcggattaaggggtttatttagtctcattctggga
# gaagaaaatgccacagatgatacccagcgtatgatgcaaatgagtgggttcggcgttgatcctacaaagcactgcacaagtatgtga]
# protein sequence = [MAEDLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDSKIVREGQVIVRARNLRAAANYIPAKSFRARKVY
# FNNEICASENDHNKADITHRTRTGWMKWRVAPSMLWVESMLPNLNGKLCVYLLAGFALWAASIVITHRSQENGLLHVPKGQAQNAQAQMFSDPNMAMD
# MMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENATDDTQRMMQMSGFGV
# DPTKHCTSM]
NW_003724208.1	AUGUSTUS	transcript	172306	180373	0.01	-	.	g32.t3
NW_003724208.1	AUGUSTUS	tts	172306	172306	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	172306	173336	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	stop_codon	173085	173087	.	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	terminal	173085	173336	0.33	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	173452	173635	0.23	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	174621	174766	0.08	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177249	177307	0.84	-	2	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177487	177548	0.93	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	177677	177776	0.97	-	2	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178217	178265	1	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	178357	178476	0.99	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	internal	179883	179976	0.84	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	initial	180064	180215	0.99	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	173337	173451	0.33	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	173636	174620	0.32	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	174767	177248	0.07	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177308	177486	0.84	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177549	177676	0.97	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	177777	178216	1	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178266	178356	1	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	178477	179882	0.18	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	intron	179977	180063	0.99	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	173085	173336	0.33	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	173452	173635	0.23	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	173452	173635	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	174621	174766	0.08	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	174621	174766	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177249	177307	0.84	-	2	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177249	177307	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177487	177548	0.93	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177487	177548	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	177677	177776	0.97	-	2	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	177677	177776	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178217	178265	1	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178217	178265	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	178357	178476	0.99	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	178357	178476	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	179883	179976	0.84	-	1	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	179883	179976	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	CDS	180064	180215	0.99	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	exon	180064	180373	.	-	.	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	start_codon	180213	180215	.	-	0	transcript_id "g32.t3"; gene_id "g32";
NW_003724208.1	AUGUSTUS	tss	180373	180373	.	-	.	transcript_id "g32.t3"; gene_id "g32";
# coding sequence = [atggcggaagatctggtgctggacacggccatcagagattgggtgcttataccactgtcggtggtgatggttctcatcg
# gggtgctccgctatttcgtctccaagctcatgcgatcctctcaagtgcccgattccaaaatcgttagagaagggcaggtgattgttagggctcgaaac
# ttgcgggcggcggcgaattacattccggccaaatcgtttcgtgctaggaaagtttacttcaataacgaggaaaatggattactgcatgttcctaaggg
# tcaggcgcaaaatgctcaggcacaaatgttctctgatccaaacatggctatggatatgatgaagaagaacctttcaatgatcataccccagactctta
# cttttgcttgggttaactttttcttctctggatttgtagcagccaagatacctttccccttgactcagaggtttcgctccatgttacaaaatggaatt
# gatttgagcactgtagatgttagctatgtcagcagtcgctcatggtacttcctcaacctgttcggattaaggggtttatttagtctcattctgggaga
# agaaaatgccacagatgatacccagcgtatgatgcaaatgagtgggttcggcgttgatcctacaaagctgtggattcttacacccaaccaaatgaaca
# taaacctcatatacccttttggtttcagaaggcattacaacaaggccatgcctagtgttaaatcaagaaaagcttttcacattaccatgtactatatg
# ttaactagtgatctaagtttcaatgaagatgcttccttgcctctgaatgttcttctgttaatgtccttacaagtctatattaagaatctaagatcaag
# gaagctgtcttctgcactgccttcttgcccttccatgcaaggtgacatttattggcattcacagctcagtcaaatgagggtggtgccctttgatgctg
# ctcaaatggaatcatcctgtgttgcccatctgccagtggtggggcaagcaggcaatgatgagtcacttgagctaggcaatggttgccatttcagttat
# tacttggcagatcaaggcttattctctctcatgcctcaaccgatggctaaaagggatgaaagcaagtttacatcaaagctaatgtttatgaaaggatg
# tttctcttttagaagtgacaacaaaaaccccatcatgccatctgatattcttctagtataa]
# protein sequence = [MAEDLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDSKIVREGQVIVRARNLRAAANYIPAKSFRARKVY
# FNNEENGLLHVPKGQAQNAQAQMFSDPNMAMDMMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN
# LFGLRGLFSLILGEENATDDTQRMMQMSGFGVDPTKLWILTPNQMNINLIYPFGFRRHYNKAMPSVKSRKAFHITMYYMLTSDLSFNEDASLPLNVLL
# LMSLQVYIKNLRSRKLSSALPSCPSMQGDIYWHSQLSQMRVVPFDAAQMESSCVAHLPVVGQAGNDESLELGNGCHFSYYLADQGLFSLMPQPMAKRD
# ESKFTSKLMFMKGCFSFRSDNKNPIMPSDILLV]
# end gene g32
###
# start gene g33
NW_003724208.1	AUGUSTUS	gene	182188	184582	0.06	+	.	g33
NW_003724208.1	AUGUSTUS	transcript	182188	184582	0.06	+	.	g33.t1
NW_003724208.1	AUGUSTUS	tss	182188	182188	.	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	exon	182188	182661	.	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	start_codon	182244	182246	.	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	initial	182244	182661	0.53	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	internal	183004	183085	0.51	+	2	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	internal	184255	184306	0.75	+	1	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	terminal	184376	184519	0.49	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	intron	182662	183003	0.5	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	intron	183086	184254	0.54	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	intron	184307	184375	0.67	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	CDS	182244	182661	0.53	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	CDS	183004	183085	0.51	+	2	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	exon	183004	183085	.	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	CDS	184255	184306	0.75	+	1	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	exon	184255	184306	.	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	CDS	184376	184519	0.49	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	exon	184376	184582	.	+	.	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	stop_codon	184517	184519	.	+	0	transcript_id "g33.t1"; gene_id "g33";
NW_003724208.1	AUGUSTUS	tts	184582	184582	.	+	.	transcript_id "g33.t1"; gene_id "g33";
# coding sequence = [atgggcttaatctccttccccaccaatgtattctgccgcagaccactgtcgatctctcctccattgcgaaccaaatcaa
# gttgttcgtacaatccttggcttaatctgaagtccattctgaagagacagcctcaaagagctcaagttttcaatgatcctcttctgccattgtcgaac
# caggctgtagttcagaggggcttgtctttaaggcgcaaacgcttaccgccggtagtatcgtgcagttctgaaagcacagggccaagggaagaagataa
# cagagctctggaagctgtccagaagctttacactgctattaagaacaaaaatgtgaaggaagtctcagatgtaattggagatgaatgccgatgtttct
# gcaattttatctcagcttcccaacccttccatggaaaaaaggtagaatggaaaaacaatccggtgcctctgggaactggtttcagctactacgtgtgc
# caagaataccgagggagggtggtgataaagaacgttaatatgcttatggacccgctgattcaccttggacccctcagactgagaattgcggggatagt
# gacgctcgtaatggacaagtttgagcacttaaacttcgagggtaagagaaagaaagatatatacatgtttctcattctttccttcacctttgccatac
# tgttctttctaataacggcttcccattaa]
# protein sequence = [MGLISFPTNVFCRRPLSISPPLRTKSSCSYNPWLNLKSILKRQPQRAQVFNDPLLPLSNQAVVQRGLSLRRKRLPPVV
# SCSSESTGPREEDNRALEAVQKLYTAIKNKNVKEVSDVIGDECRCFCNFISASQPFHGKKVEWKNNPVPLGTGFSYYVCQEYRGRVVIKNVNMLMDPL
# IHLGPLRLRIAGIVTLVMDKFEHLNFEGKRKKDIYMFLILSFTFAILFFLITASH]
# end gene g33
###
# start gene g34
NW_003724208.1	AUGUSTUS	gene	184615	185203	0.86	-	.	g34
NW_003724208.1	AUGUSTUS	transcript	184615	185203	0.38	-	.	g34.t1
NW_003724208.1	AUGUSTUS	tts	184615	184615	.	-	.	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	exon	184615	185203	.	-	.	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	stop_codon	184778	184780	.	-	0	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	single	184778	185179	0.42	-	0	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	CDS	184778	185179	0.42	-	0	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	start_codon	185177	185179	.	-	0	transcript_id "g34.t1"; gene_id "g34";
NW_003724208.1	AUGUSTUS	tss	185203	185203	.	-	.	transcript_id "g34.t1"; gene_id "g34";
# coding sequence = [atggctaggactactgacattggttttgtgctgggggtgatagtggtagtgcttgttgcagtggtgggtggagccaagt
# ccatgaccatatgcagcatggactcaacccagctggctcagtgcctccctgcaattcgaggcccatcaccatcccctcctactaaagagtgttgtgca
# gtcatccaaaaggccgatatgcactgcttgtgcagctacaagcatgccctccccaactttggcgtcaaccctggactcgccatggccttgcccaagaa
# gtgtggcctcaacccaccacccgaatgtgacggtaagcctcctagccttgcatctaccatatcaagaacgataaccatatcatatcaagaatgctcat
# ttctcagttcttgctctgcaggtccttga]
# protein sequence = [MARTTDIGFVLGVIVVVLVAVVGGAKSMTICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHALPN
# FGVNPGLAMALPKKCGLNPPPECDGKPPSLASTISRTITISYQECSFLSSCSAGP]
NW_003724208.1	AUGUSTUS	transcript	184615	185203	0.48	-	.	g34.t2
NW_003724208.1	AUGUSTUS	tts	184615	184615	.	-	.	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	exon	184615	184785	.	-	.	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	stop_codon	184778	184780	.	-	0	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	terminal	184778	184785	0.51	-	2	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	initial	184873	185179	0.58	-	0	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	intron	184786	184872	0.51	-	.	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	CDS	184778	184785	0.51	-	2	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	CDS	184873	185179	0.58	-	0	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	exon	184873	185203	.	-	.	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	start_codon	185177	185179	.	-	0	transcript_id "g34.t2"; gene_id "g34";
NW_003724208.1	AUGUSTUS	tss	185203	185203	.	-	.	transcript_id "g34.t2"; gene_id "g34";
# coding sequence = [atggctaggactactgacattggttttgtgctgggggtgatagtggtagtgcttgttgcagtggtgggtggagccaagt
# ccatgaccatatgcagcatggactcaacccagctggctcagtgcctccctgcaattcgaggcccatcaccatcccctcctactaaagagtgttgtgca
# gtcatccaaaaggccgatatgcactgcttgtgcagctacaagcatgccctccccaactttggcgtcaaccctggactcgccatggccttgcccaagaa
# gtgtggcctcaacccaccacccgaatgtgacggtccttga]
# protein sequence = [MARTTDIGFVLGVIVVVLVAVVGGAKSMTICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHALPN
# FGVNPGLAMALPKKCGLNPPPECDGP]
# end gene g34
###
# start gene g35
NW_003724208.1	AUGUSTUS	gene	186522	190963	0.02	-	.	g35
NW_003724208.1	AUGUSTUS	transcript	186522	190963	0.02	-	.	g35.t1
NW_003724208.1	AUGUSTUS	tts	186522	186522	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	186522	187484	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	stop_codon	187323	187325	.	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	terminal	187323	187484	0.46	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	internal	187758	187838	0.5	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	internal	188688	188875	0.81	-	2	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	internal	188964	189135	1	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	internal	189250	189361	0.95	-	1	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	initial	190298	190734	0.91	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	intron	187485	187757	0.45	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	intron	187839	188687	0.7	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	intron	188876	188963	1	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	intron	189136	189249	0.95	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	intron	189362	190297	0.98	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	187323	187484	0.46	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	187758	187838	0.5	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	187758	187838	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	188688	188875	0.81	-	2	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	188688	188875	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	188964	189135	1	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	188964	189135	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	189250	189361	0.95	-	1	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	189250	189361	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	CDS	190298	190734	0.91	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	exon	190298	190963	.	-	.	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	start_codon	190732	190734	.	-	0	transcript_id "g35.t1"; gene_id "g35";
NW_003724208.1	AUGUSTUS	tss	190963	190963	.	-	.	transcript_id "g35.t1"; gene_id "g35";
# coding sequence = [atggtgtcggatcaagatatcgcgaaaggtgtggagacactgctccgtcagtctgagcccaactcattcacctccttaa
# acggcgtcgttaagcagctggaagccaaactagggctcgacctgtcccataaggctgtcttcatcagagaccagatcagtttcctgctccggtctcac
# cctcagccccttcccccaaaagaccattttgccctccagcaacacccccaattcctcagtccccacccccaaatcccttcccattttgcccttcagca
# ccaccgcccaccgccggaagacctcaacttcctgtaccccctcccccagcctcagcagcatcagccgcagacgcagccgcagccgcagccgcatcacc
# tgccgaaaggtgaagcctttctgcagaatgcagctagtgtcgccgcccaagcgcccaaagaaagtgctccagctgcacccaaaagaagaggcggctcg
# gggggtctaaacaaagtctgtggggtttcaactgaacttcaggctgttgttggcgagccaaccatgccaaggacacagattgtgaagcagctttgggc
# atacattaggaaaaacaacctccaagatcctagtaacaagcgaaagataatttgtgatgatgccctccgcttggtgttcgagacagattctactgata
# tgttcaagatgaataagttgcttgctaaacatatcattccgcttgaaccttcaagagaatccagtcaagctaaacggttgaaggtggatgttgagtct
# gcaactgaaagtagtgaagccagtccatctcctgtaatgatatctgatgcacttgccacattttttggtactggagaaagggagatgctccaagaaga
# ggccctaaggcgtgtttgggagtacataaaggtcaaccaattagaggatcctctaaattcaatggcaatactatgtgatgcaaagcttcgggagctct
# ttggatgtgaaagtatttctgcactgggggggttcatgaatctcaaactcaatgcagttttgagggctagttggagcttcacttctcttgggatctcc
# atcttctttcacattcagatactagtaactttcttatcactgttagttcaggctgtagttctgaagcttcagcctgaggtcctgagtgtctga]
# protein sequence = [MVSDQDIAKGVETLLRQSEPNSFTSLNGVVKQLEAKLGLDLSHKAVFIRDQISFLLRSHPQPLPPKDHFALQQHPQFL
# SPHPQIPSHFALQHHRPPPEDLNFLYPLPQPQQHQPQTQPQPQPHHLPKGEAFLQNAASVAAQAPKESAPAAPKRRGGSGGLNKVCGVSTELQAVVGE
# PTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLEPSRESSQAKRLKVDVESATESSEASPSPVMISDALA
# TFFGTGEREMLQEEALRRVWEYIKVNQLEDPLNSMAILCDAKLRELFGCESISALGGFMNLKLNAVLRASWSFTSLGISIFFHIQILVTFLSLLVQAV
# VLKLQPEVLSV]
# end gene g35
###
# start gene g36
NW_003724208.1	AUGUSTUS	gene	205626	207093	0.15	-	.	g36
NW_003724208.1	AUGUSTUS	transcript	205626	207093	0.15	-	.	g36.t1
NW_003724208.1	AUGUSTUS	tts	205626	205626	.	-	.	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	exon	205626	207093	.	-	.	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	stop_codon	205809	205811	.	-	0	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	single	205809	206927	0.62	-	0	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	CDS	205809	206927	0.62	-	0	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	start_codon	206925	206927	.	-	0	transcript_id "g36.t1"; gene_id "g36";
NW_003724208.1	AUGUSTUS	tss	207093	207093	.	-	.	transcript_id "g36.t1"; gene_id "g36";
# coding sequence = [atggagggcgagttcaacaacttcgtcatggtatgggtcttggccttcgtctctttttcctactgttacaccatggcca
# agatcatccccagtggcagagccaggctcctcactatcatcccagttatggctctcttcttgttccttcctctcaggctcaatactctgcatcttggc
# ggcacatttgctttcttcattgcctggttggccaacttcaagcttctcctttttgccttcggcgaaggccctttagcatccgacccatcaatctccct
# cctccgtttcgcagccctggcttctctaccaatcaaaatccagcaaaatccacctcccaatgacccttacagagagaacccatctcttgaaaagccca
# aaaagggacagaagtcacctctagtttctactgtaaagggtgttgttttggccgtggtgatcgttgcggctcacttcagcgaggatatgcatccaatt
# gtttcattattcctcctgatcttccaaatgtacttgagcttggaattcattctagcattagttgcaaccctccctcgagttcttctgggcatggagct
# cgctccacagttcaatgaaccctacctctccacctccctccaagacttctggggaagacgatggaacatcatggcttccagtatcctgcgccccaccg
# tgtacttacccaccctccacgtctcggcgcggctcttcggccggaagtgggccccaattccggcggtcatggcaacattcattgtgtcggcggtgatg
# cacgagctgatattctactacatggggaggacggcgcccacctggcacatcagcttcttctttgtcctccacggcctctgtttgacgttcgagctcgc
# tctgaagaaggttctcggcggaattctggcccttccggcatttgtctctggtccgttgacggtcgccttcgtggtgtcaactggcttctggctcttct
# tccctcagctcctccgccttaaggccgacgtgagagcgattgaggagtacgccgcttttgtcgcgtttctcaaggatattggtcgggctttgacattc
# aaccttatcagaggttatcaaagtgccacgtatgaatcttttgttcatgattatccatga]
# protein sequence = [MEGEFNNFVMVWVLAFVSFSYCYTMAKIIPSGRARLLTIIPVMALFLFLPLRLNTLHLGGTFAFFIAWLANFKLLLFA
# FGEGPLASDPSISLLRFAALASLPIKIQQNPPPNDPYRENPSLEKPKKGQKSPLVSTVKGVVLAVVIVAAHFSEDMHPIVSLFLLIFQMYLSLEFILA
# LVATLPRVLLGMELAPQFNEPYLSTSLQDFWGRRWNIMASSILRPTVYLPTLHVSARLFGRKWAPIPAVMATFIVSAVMHELIFYYMGRTAPTWHISF
# FFVLHGLCLTFELALKKVLGGILALPAFVSGPLTVAFVVSTGFWLFFPQLLRLKADVRAIEEYAAFVAFLKDIGRALTFNLIRGYQSATYESFVHDYP]
# end gene g36
###
# start gene g37
NW_003724208.1	AUGUSTUS	gene	210348	214473	0.02	+	.	g37
NW_003724208.1	AUGUSTUS	transcript	210348	214473	0.02	+	.	g37.t1
NW_003724208.1	AUGUSTUS	tss	210348	210348	.	+	.	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	exon	210348	210626	.	+	.	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	exon	212341	212388	.	+	.	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	exon	213543	214473	.	+	.	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	start_codon	213991	213993	.	+	0	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	single	213991	214305	0.49	+	0	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	CDS	213991	214305	0.49	+	0	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	stop_codon	214303	214305	.	+	0	transcript_id "g37.t1"; gene_id "g37";
NW_003724208.1	AUGUSTUS	tts	214473	214473	.	+	.	transcript_id "g37.t1"; gene_id "g37";
# coding sequence = [atggcaaagatggagaagaacaagcagctctctacaatggctgcagtgctgatgttgcagctggtgttttggctgacga
# tctcaccagcactgagctgcccgtcagatggcagcgagtgtaaggactgcatcgttaatcagatgaggaacgtttgcccatcatgcgcacctgttcta
# agctgcatggcacgatgcttgtggggtggcgcatcgaaatctaagtgtgttaagaggtgtgattgttatgggggaaagccaaggctctcggattgcaa
# gaaatgcatgtcaaggtgcaaatgcagctgtgaggcgtag]
# protein sequence = [MAKMEKNKQLSTMAAVLMLQLVFWLTISPALSCPSDGSECKDCIVNQMRNVCPSCAPVLSCMARCLWGGASKSKCVKR
# CDCYGGKPRLSDCKKCMSRCKCSCEA]
# end gene g37
###
# start gene g38
NW_003724208.1	AUGUSTUS	gene	214558	218443	0.21	-	.	g38
NW_003724208.1	AUGUSTUS	transcript	214558	218443	0.21	-	.	g38.t1
NW_003724208.1	AUGUSTUS	tts	214558	214558	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	exon	214558	215340	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	stop_codon	214911	214913	.	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	terminal	214911	215340	0.98	-	1	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	internal	215764	215975	0.97	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	internal	216608	216730	1	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	internal	217103	217300	1	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	initial	217951	218337	0.89	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	intron	215341	215763	0.98	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	intron	215976	216607	0.85	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	intron	216731	217102	1	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	intron	217301	217950	0.77	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	CDS	214911	215340	0.98	-	1	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	CDS	215764	215975	0.97	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	exon	215764	215975	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	CDS	216608	216730	1	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	exon	216608	216730	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	CDS	217103	217300	1	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	exon	217103	217300	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	CDS	217951	218337	0.89	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	exon	217951	218443	.	-	.	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	start_codon	218335	218337	.	-	0	transcript_id "g38.t1"; gene_id "g38";
NW_003724208.1	AUGUSTUS	tss	218443	218443	.	-	.	transcript_id "g38.t1"; gene_id "g38";
# coding sequence = [atggagggagaatggaagcagaagaggctgtatcctttgctcggaactctctctattctcctttttctctacttcaact
# tctccgactacttcaattttcctgtgctgtggctccctgccataggcttcgtggggacgaactccaccaagttcgtcattgtcgaacctgatggctct
# caccagtccacgctctacatcaacggctggaactcctactggttgatggaggagagcgtctgggccccttcgagatctagggtttcaaatatgctcag
# aagaggagctgagatgggtatgagcgtttgtcgaacttgggctttcaatgatggagatggccccaattctcttcagatatcacctggagtcttcaatg
# aaagagtgtttcagggcttagactatgtgatagttgaagctaggaggcaccaagtcagattgatcctcagtctagtcaataatctgaatgcctacggt
# ggtaaagcacagtatgtgaggtgggcacaagaagctggaatcaatgtctcttcctcaactgattcgtttttttcacacccaaccataaaagattacta
# caaagcttacatcaaggctgttgtgacaagaaagaattccttgagtggagttaaatattctgaggaaccagctatatttgcatgggagctcatgaatg
# agcctcggtgtgcatcaagttcttctgctcctattctgcaggcttggatcacagaaatggctgcatatatcaagagtttggaccaaaagcaccttgtc
# actgttgggcttgagggattttatggtctgaaaacgactgaaagatctggagtgaatcctggggattgggcatctaagcttggatcagactttataca
# aaactcagcaattgatgatattgattttgcttcagttcatgcatatcctgacagctggctcccagatgctgatttggaagagaaagcaaattttcttt
# cacattgggtggattctcacataagtgatggggaatatgtcctgaagaaaccagttcttttcacagaagttggctccattatgcataggaagaaacaa
# ggattatatgatacagatactttcttgaagacagtttacgataaaatttatgagtctgcaaagaagaggcaagcaggagcaggagccttgatctggca
# gttactagttgaagggatggaggaatatagcgaccaattttccattgttgcatgggattatccctccacccatgaactgataatagaacagtcatgta
# ggcttcggagcgtttttgcagaaggccaagtggaaaggaaacttcaacatggtgatctctgctttggtaaagtatttaacaacagcaatgagtaa]
# protein sequence = [MEGEWKQKRLYPLLGTLSILLFLYFNFSDYFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYINGWNSYWLMEES
# VWAPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVFQGLDYVIVEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSS
# TDSFFSHPTIKDYYKAYIKAVVTRKNSLSGVKYSEEPAIFAWELMNEPRCASSSSAPILQAWITEMAAYIKSLDQKHLVTVGLEGFYGLKTTERSGVN
# PGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYES
# AKKRQAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSVFAEGQVERKLQHGDLCFGKVFNNSNE]
# end gene g38
###
# start gene g39
NW_003724208.1	AUGUSTUS	gene	219005	219923	0.09	-	.	g39
NW_003724208.1	AUGUSTUS	transcript	219005	219923	0.09	-	.	g39.t1
NW_003724208.1	AUGUSTUS	tts	219005	219005	.	-	.	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	exon	219005	219923	.	-	.	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	stop_codon	219169	219171	.	-	0	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	single	219169	219822	0.87	-	0	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	CDS	219169	219822	0.87	-	0	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	start_codon	219820	219822	.	-	0	transcript_id "g39.t1"; gene_id "g39";
NW_003724208.1	AUGUSTUS	tss	219923	219923	.	-	.	transcript_id "g39.t1"; gene_id "g39";
# coding sequence = [atgaaaccctctcgtagattcagcttcttctcctcctcctcctcttcctcttcctctacaaccaccactacagtgatat
# acactttccgtgacgaccaaactacccctcatccccaattcaatgaaattcccatccattcctcacccgaaccccccatccccatcaccgtccacctc
# cctcaaccgtcggaatccgccgccgccgtagccatccaatcggcctaccgcgcccacctgatccgcactcttgtccggaaaatctccgccgtgagctc
# cgaggccgaccacctgcagcgcctaatccagcggcaggaaaccgtggacgccatccggagcgacgatcgcgagaagctgaagatgaacgaggccttga
# tggctctgctcctgaagctcgactccgtgccggggcttgatccggcagtgcgggacctccggaggtccgtgagccgtcggatcgttgggatgcaggag
# attctagactcggtttccgacaccagaacggacggatgggatggattcttgaggaattgggacaaggccatagatgagatggaagaagaagtttgtaa
# agagagaggcggggatgaaatggagaggttttgtgcagagcatttagggttccggtgcctccagaggtttctccgagaggcatag]
# protein sequence = [MKPSRRFSFFSSSSSSSSSTTTTTVIYTFRDDQTTPHPQFNEIPIHSSPEPPIPITVHLPQPSESAAAVAIQSAYRAH
# LIRTLVRKISAVSSEADHLQRLIQRQETVDAIRSDDREKLKMNEALMALLLKLDSVPGLDPAVRDLRRSVSRRIVGMQEILDSVSDTRTDGWDGFLRN
# WDKAIDEMEEEVCKERGGDEMERFCAEHLGFRCLQRFLREA]
# end gene g39
###
# start gene g40
NW_003724208.1	AUGUSTUS	gene	220227	224103	0.03	-	.	g40
NW_003724208.1	AUGUSTUS	transcript	220227	224103	0.03	-	.	g40.t1
NW_003724208.1	AUGUSTUS	tts	220227	220227	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	220227	220507	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	stop_codon	220445	220447	.	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	terminal	220445	220507	0.51	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	221095	221220	0.72	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	221363	221459	0.98	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	221961	222025	0.98	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	222261	222323	1	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	222454	222524	1	-	2	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	222621	222680	0.99	-	2	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	222766	222865	1	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	223036	223108	1	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	223618	223692	0.99	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	internal	223806	223930	0.53	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	initial	224016	224018	0.55	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	220508	221094	0.45	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	221221	221362	0.73	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	221460	221960	0.89	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	222026	222260	0.98	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	222324	222453	1	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	222525	222620	0.99	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	222681	222765	0.99	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	222866	223035	1	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	223109	223617	0.98	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	223693	223805	0.98	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	intron	223931	224015	0.54	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	220445	220507	0.51	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	221095	221220	0.72	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	221095	221220	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	221363	221459	0.98	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	221363	221459	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	221961	222025	0.98	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	221961	222025	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	222261	222323	1	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	222261	222323	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	222454	222524	1	-	2	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	222454	222524	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	222621	222680	0.99	-	2	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	222621	222680	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	222766	222865	1	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	222766	222865	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	223036	223108	1	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	223036	223108	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	223618	223692	0.99	-	1	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	223618	223692	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	223806	223930	0.53	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	223806	223930	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	CDS	224016	224018	0.55	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	exon	224016	224103	.	-	.	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	start_codon	224016	224018	.	-	0	transcript_id "g40.t1"; gene_id "g40";
NW_003724208.1	AUGUSTUS	tss	224103	224103	.	-	.	transcript_id "g40.t1"; gene_id "g40";
# coding sequence = [atgaacaaggtagaaatgtgtcttcctatggtgataggggactattcagacttcttttcgtccatgcatcatgcaagga
# actgtgggagcatatttcgtggaccagaggacccgattggagcaaactggttccaccttcctattgcttatcatgggcgggcatcgtctattgttata
# tctggaactgatcttattcggccaaaaggccaaggtcatccaattggcaattcaccatattttggaccttcaagaaagctagactttgagctagaaat
# ggctgctatagttggtcctggtaatgaattaggaaagcctgtggatgttaatgaggctgcagatcacatctttggacttgtgatcatgaatgactgga
# gtgcaagagatattcaggcatgggaatatgtgcctcttgggccttttcttgggaagagttttggtacaacactatccccttggattgtgacccttgat
# gctctagagccctttgcttgtgatgctccaaaacaggaccctcctcccttgccgtatctggctgaaaaaatatcccaaaactatgacatttccttaga
# ggttgggattaaacctgctggacataaaaattcgtgcattgtcacaaggagtaacttaaagcacttatattggacactgactcaacaacttgcacacc
# atacaatcaatggttgcaacttaaggccaggcgatctccttggaactggaaccataagtggacctgaaccggaatctttgggatgcttgctagaatta
# acatggaatggacaaaagccagtatctttggatggaacaacccgtggatttcttgaagatggagatgaagtcactatcactggttattgcaagggcaa
# tggttacaaagttgggttcggaacatgctcaggcaagattcttccatcatctccttga]
# protein sequence = [MNKVEMCLPMVIGDYSDFFSSMHHARNCGSIFRGPEDPIGANWFHLPIAYHGRASSIVISGTDLIRPKGQGHPIGNSP
# YFGPSRKLDFELEMAAIVGPGNELGKPVDVNEAADHIFGLVIMNDWSARDIQAWEYVPLGPFLGKSFGTTLSPWIVTLDALEPFACDAPKQDPPPLPY
# LAEKISQNYDISLEVGIKPAGHKNSCIVTRSNLKHLYWTLTQQLAHHTINGCNLRPGDLLGTGTISGPEPESLGCLLELTWNGQKPVSLDGTTRGFLE
# DGDEVTITGYCKGNGYKVGFGTCSGKILPSSP]
# end gene g40
###
# start gene g41
NW_003724208.1	AUGUSTUS	gene	250877	252283	0.28	-	.	g41
NW_003724208.1	AUGUSTUS	transcript	250877	252283	0.28	-	.	g41.t1
NW_003724208.1	AUGUSTUS	tts	250877	250877	.	-	.	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	exon	250877	252283	.	-	.	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	stop_codon	251060	251062	.	-	0	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	single	251060	252178	0.87	-	0	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	CDS	251060	252178	0.87	-	0	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	start_codon	252176	252178	.	-	0	transcript_id "g41.t1"; gene_id "g41";
NW_003724208.1	AUGUSTUS	tss	252283	252283	.	-	.	transcript_id "g41.t1"; gene_id "g41";
# coding sequence = [atggagggcgagctcaacaacttcgtcatggtatgggtcttggccttcgtctctttttcctactgttacaccatggcca
# agatcatccccagtggcagagccaggctcctcactatcatcccagttatggctttcttcttgttccttcctctcagactcaatactctgcatcttggc
# ggcacatttgctttcttcattgcctggttggccaacttcaagcttctcctttttgccttcggcgaaggccctttagcatccgacccatcaatctccct
# cctccgtttcgcagccctggcttctttaccaatcaaaatccagcaaaatccgcctcccaatggcccttacagagagaacccatctcttgaaaagccca
# aaaagggacagaagtcgcctgtggtttatactgtaaagggtgtggttttggccatggtgatcgttgcggctcacttcagtgaggatatgcatccaatt
# gtttcattattcctcctgctcttccaaatgtacttgagcttggaattcattctagcattagttgcaaccctccctcgagttcttctgggcatggagct
# cgctccacagttcaatgaaccgtacctctccacctccctccaagacttctggggaagacgatggaacatcatggctaccagtatcctgcgccccaccg
# tgtacttacccaccctccacgtctcggcgcggctcttcggccggaagtgggccccaattccggcggtcatggcaacattcattgtgtcggcggtgatg
# cacgagctgatattctactacatggggaggacggcgcccacctggcacatcagcttcttcttcgtcctccacggcctctgtttgacggtcgagctcgc
# tctgaagaaggttctcggcggaattccggcccttccggcatttgtctctggtccgttgacggtcgccttcgtggtgtcaactggcttctggctcttct
# tccctcagctcctccgccttaaggccgacgtgagagcgattgaggagtacgccgcttttgtcgcgtttctcaaggatattggtcgggctttgacattc
# aacctgatcagaggttatcaaagtgccacgtatgaatcttttgttcatgattatccatga]
# protein sequence = [MEGELNNFVMVWVLAFVSFSYCYTMAKIIPSGRARLLTIIPVMAFFLFLPLRLNTLHLGGTFAFFIAWLANFKLLLFA
# FGEGPLASDPSISLLRFAALASLPIKIQQNPPPNGPYRENPSLEKPKKGQKSPVVYTVKGVVLAMVIVAAHFSEDMHPIVSLFLLLFQMYLSLEFILA
# LVATLPRVLLGMELAPQFNEPYLSTSLQDFWGRRWNIMATSILRPTVYLPTLHVSARLFGRKWAPIPAVMATFIVSAVMHELIFYYMGRTAPTWHISF
# FFVLHGLCLTVELALKKVLGGIPALPAFVSGPLTVAFVVSTGFWLFFPQLLRLKADVRAIEEYAAFVAFLKDIGRALTFNLIRGYQSATYESFVHDYP]
# end gene g41
###
# start gene g42
NW_003724208.1	AUGUSTUS	gene	257058	258381	0.03	+	.	g42
NW_003724208.1	AUGUSTUS	transcript	257058	258381	0.03	+	.	g42.t1
NW_003724208.1	AUGUSTUS	tss	257058	257058	.	+	.	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	exon	257058	257427	.	+	.	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	start_codon	257278	257280	.	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	initial	257278	257427	0.74	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	terminal	257544	257552	0.68	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	intron	257428	257543	0.69	+	.	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	CDS	257278	257427	0.74	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	CDS	257544	257552	0.68	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	exon	257544	258381	.	+	.	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	stop_codon	257550	257552	.	+	0	transcript_id "g42.t1"; gene_id "g42";
NW_003724208.1	AUGUSTUS	tts	258381	258381	.	+	.	transcript_id "g42.t1"; gene_id "g42";
# coding sequence = [atgagacctgattcttctgttttgctgaggtgtcaagatcatagtggctcaaagccccaccctctaaatcagtacaagc
# tgcgttataccgcagcagcacaacaaagaaagagaggacgaagcttcgcgatcggatcatcgaatcctcaaatcagataa]
# protein sequence = [MRPDSSVLLRCQDHSGSKPHPLNQYKLRYTAAAQQRKRGRSFAIGSSNPQIR]
# end gene g42
###
# start gene g43
NW_003724208.1	AUGUSTUS	gene	260888	261483	0.06	+	.	g43
NW_003724208.1	AUGUSTUS	transcript	260888	261483	0.06	+	.	g43.t1
NW_003724208.1	AUGUSTUS	tss	260888	260888	.	+	.	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	exon	260888	261483	.	+	.	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	start_codon	261001	261003	.	+	0	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	single	261001	261315	0.6	+	0	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	CDS	261001	261315	0.6	+	0	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	stop_codon	261313	261315	.	+	0	transcript_id "g43.t1"; gene_id "g43";
NW_003724208.1	AUGUSTUS	tts	261483	261483	.	+	.	transcript_id "g43.t1"; gene_id "g43";
# coding sequence = [atggcaaagatggagaagaacaagcagctctctacaatggctgcagtgctgatgttgctgctggtgttttggctgatga
# tctcaccagcactgggctgcccgtcagatggcagcgagtgtaaggactgcatcgttaatcagatgaggaacggttgcccatcatgcgcacctgttcta
# cgctgcatggcacgatgcttgtggggtggcacatcgaaatctaagtgtgttaagaggtgtgattgttatgggggaaagccaaggctctcggattgcaa
# gaaatgcatgtcaaggtgcaaatgcagctgtgaggcgtag]
# protein sequence = [MAKMEKNKQLSTMAAVLMLLLVFWLMISPALGCPSDGSECKDCIVNQMRNGCPSCAPVLRCMARCLWGGTSKSKCVKR
# CDCYGGKPRLSDCKKCMSRCKCSCEA]
# end gene g43
###
# start gene g44
NW_003724208.1	AUGUSTUS	gene	261564	265403	0.36	-	.	g44
NW_003724208.1	AUGUSTUS	transcript	261564	265403	0.36	-	.	g44.t1
NW_003724208.1	AUGUSTUS	tts	261564	261564	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	exon	261564	262361	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	stop_codon	261926	261928	.	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	terminal	261926	262361	0.78	-	1	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	internal	262785	262996	0.99	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	internal	263629	263751	1	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	internal	264124	264321	1	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	initial	264908	265294	0.89	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	intron	262362	262784	1	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	intron	262997	263628	0.91	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	intron	263752	264123	1	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	intron	264322	264907	0.99	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	CDS	261926	262361	0.78	-	1	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	CDS	262785	262996	0.99	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	exon	262785	262996	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	CDS	263629	263751	1	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	exon	263629	263751	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	CDS	264124	264321	1	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	exon	264124	264321	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	CDS	264908	265294	0.89	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	exon	264908	265403	.	-	.	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	start_codon	265292	265294	.	-	0	transcript_id "g44.t1"; gene_id "g44";
NW_003724208.1	AUGUSTUS	tss	265403	265403	.	-	.	transcript_id "g44.t1"; gene_id "g44";
# coding sequence = [atggagggagaatggaagcagaagaggctgtatcctttgctcggaactctctctattctcctttttctctacttcaact
# tctccgactacttcaattttcctgtgctgtggctccctgccataggcttcgtggggacgaactccaccaagttcgtcattgtcgaacctgatggctct
# caccagtccacgctctacatcaacggctggaactcctactggttgatggaggagagcgtctggggcccttcgagatctagggtttcaaatatgctcag
# aagaggagctgagatgggtatgagcgtttgtcgaacttgggctttcaatgatggagatggccccaattctcttcagatatcacctggagtcttcaatg
# aaagagtgtttcagggcttagactatgtgatatttgaagctaggaggcaccaagtcagattgatcctcagtctagtcaataatctgaatgcctacggt
# ggtaaagcacagtatgtgaggtgggcacaagaagctggaatcaatgtctcttcctcaactgattcgtttttttcacacccaaccataaaagattacta
# caaagcttacatcaaggctgttgtgacaagaaagaattccttgagtggagttaaatattctgaggaaccagctatatttggatgggagctcatgaatg
# agcctcggtgtgcatcaagttcttctgctcctattctgcaggcttggatcacagaaatggctgcatttatcaagagtttggaccaaaagcaccttgtc
# actgttgggcttgagggattttatggtctgaaaacgactgaaagatctggagtgaatcctggggattgggcatctaagcttggatcagactttataca
# aaactcagcaattgatgatattgattttgcttcagttcatgcatatcctgacagctggctcccagatgctgatttggaagagaaagcaaattttcttt
# cacattgggtggattctcacataagtgatggggaatatgtcctgaagaaaccagttcttttcacagaagttggctccattatgcataggaagaaacaa
# ggattatatgatacagatactttcttgaagacagtttacgataaaatttatgagtctgcaaagaagaggcaagcaggagcaggagcaggagccttgat
# ctggcagttactagttgaagggatggaggaatatagcgaccaattttccattgttgcatgggattatccctccacccatgaactgataattgaacagt
# catgtaggcttcggagcgtttttgcagaaggccaagtggaaaggaaacttcaacatggtgatctctgctttggtaaagtatttaacaacagcaatgag
# taa]
# protein sequence = [MEGEWKQKRLYPLLGTLSILLFLYFNFSDYFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYINGWNSYWLMEES
# VWGPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVFQGLDYVIFEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSS
# TDSFFSHPTIKDYYKAYIKAVVTRKNSLSGVKYSEEPAIFGWELMNEPRCASSSSAPILQAWITEMAAFIKSLDQKHLVTVGLEGFYGLKTTERSGVN
# PGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYES
# AKKRQAGAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSVFAEGQVERKLQHGDLCFGKVFNNSNE]
# end gene g44
###
# start gene g45
NW_003724208.1	AUGUSTUS	gene	265956	272143	0.13	-	.	g45
NW_003724208.1	AUGUSTUS	transcript	267504	272143	0.03	-	.	g45.t1
NW_003724208.1	AUGUSTUS	tts	267504	267504	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	267504	267897	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	stop_codon	267838	267840	.	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	terminal	267838	267897	0.24	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268106	268231	0.46	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268374	268470	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268970	269034	0.99	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269270	269332	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269463	269533	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269630	269689	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269775	269874	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270045	270117	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270611	270685	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270799	270923	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271009	271067	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271252	271330	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	initial	271855	272058	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	267898	268105	0.24	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268232	268373	0.67	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268471	268969	0.97	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269035	269269	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269333	269462	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269534	269629	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269690	269774	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269875	270044	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270118	270610	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270686	270798	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270924	271008	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271068	271251	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271331	271854	1	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	267838	267897	0.24	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268106	268231	0.46	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268106	268231	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268374	268470	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268374	268470	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268970	269034	0.99	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268970	269034	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269270	269332	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269270	269332	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269463	269533	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269463	269533	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269630	269689	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269630	269689	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269775	269874	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269775	269874	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270045	270117	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270045	270117	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270611	270685	1	-	1	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270611	270685	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270799	270923	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270799	270923	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271009	271067	1	-	2	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271009	271067	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271252	271330	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271252	271330	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271855	272058	1	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271855	272143	.	-	.	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	start_codon	272056	272058	.	-	0	transcript_id "g45.t1"; gene_id "g45";
NW_003724208.1	AUGUSTUS	tss	272143	272143	.	-	.	transcript_id "g45.t1"; gene_id "g45";
# coding sequence = [atggctctccagtctttcgtcgaagttcaccctgactctcacttccccatccagaaccttccgtacggtgttttccggc
# ctggaccgtctgcggaggctcggcctggcgtggcgatcggagactatgtgttggatctctcggtggttcagtccgccggtctgttcgacggtccgatt
# gtcggaaaatccgattgtttcctgcagccgaatctcaacaagttcttgggaatgaggcggcctgcatggaaggaagctcgatcgacacttcaaaagct
# gctgtcatctacagaaccaacactgcgtgacaatgcaagcttgagggaaaaagcacttgtaccaatgaacaaggtagaaatgtgtcttcctatggtga
# taggggactattcagacttcttttcgtccatgcatcatgcaaggaactgtgggagcatatttcgtggaccagaggacccgattggagcaaactggttc
# caccttcctattgcttatcatgggcgggcatcgtctattgttatatctggaactgatcttattcggccaaaaggccaaggtcatccaattggcaattc
# accatattttggaccttcaagaaagctagactttgagctagaaatggctgctatagttggtcctggtaatgaattaggaaagcctgtggatgttaatg
# aggctgcagatcatatctttggacttgtgatcatgaatgactggagtgcaagagatattcaggcatgggaatatgtgcctcttgggccttttcttggg
# aagagttttggtacaacactatccccttggattgtgacccttgatgctctagagccctttgcttgtgatgctccaaaacaggaccctcctcccttgcc
# gtatctggctgaaaaaatatcccaaaactatgacatttccttagaggttgggattaaacctgctggacataaaaattcgtgcattgtcacaaggagta
# acttaaagcacttatattggacactgactcaacaacttgcacaccatacaatcaatggttgcaacttaaggccaggcgatctccttggaactggaacc
# ataagtggacctgaaccggaatctttgggatgcttgctagaattaacatggaatggacaaaagccagtatctttggatggaacaacccgtggatttct
# tgaagatggagatgaagtcactatcactggttattgcaagcttggtgatcaaataaagtctgtggtctccttcatggtctttctatatggaggcccat
# ga]
# protein sequence = [MALQSFVEVHPDSHFPIQNLPYGVFRPGPSAEARPGVAIGDYVLDLSVVQSAGLFDGPIVGKSDCFLQPNLNKFLGMR
# RPAWKEARSTLQKLLSSTEPTLRDNASLREKALVPMNKVEMCLPMVIGDYSDFFSSMHHARNCGSIFRGPEDPIGANWFHLPIAYHGRASSIVISGTD
# LIRPKGQGHPIGNSPYFGPSRKLDFELEMAAIVGPGNELGKPVDVNEAADHIFGLVIMNDWSARDIQAWEYVPLGPFLGKSFGTTLSPWIVTLDALEP
# FACDAPKQDPPPLPYLAEKISQNYDISLEVGIKPAGHKNSCIVTRSNLKHLYWTLTQQLAHHTINGCNLRPGDLLGTGTISGPEPESLGCLLELTWNG
# QKPVSLDGTTRGFLEDGDEVTITGYCKLGDQIKSVVSFMVFLYGGP]
NW_003724208.1	AUGUSTUS	transcript	267099	272133	0.02	-	.	g45.t2
NW_003724208.1	AUGUSTUS	tts	267099	267099	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	267099	267488	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	stop_codon	267350	267352	.	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	terminal	267350	267488	0.36	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	267616	267644	0.29	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268106	268231	0.46	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268374	268470	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268970	269034	0.99	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269270	269332	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269463	269533	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269630	269689	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269775	269874	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270045	270117	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270611	270685	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270799	270923	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271009	271067	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271252	271330	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	initial	271855	272058	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	267489	267615	0.52	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	267645	268105	0.29	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268232	268373	0.67	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268471	268969	0.97	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269035	269269	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269333	269462	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269534	269629	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269690	269774	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269875	270044	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270118	270610	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270686	270798	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270924	271008	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271068	271251	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271331	271854	1	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	267350	267488	0.36	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	267616	267644	0.29	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	267616	267644	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268106	268231	0.46	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268106	268231	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268374	268470	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268374	268470	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268970	269034	0.99	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268970	269034	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269270	269332	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269270	269332	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269463	269533	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269463	269533	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269630	269689	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269630	269689	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269775	269874	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269775	269874	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270045	270117	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270045	270117	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270611	270685	1	-	1	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270611	270685	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270799	270923	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270799	270923	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271009	271067	1	-	2	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271009	271067	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271252	271330	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271252	271330	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271855	272058	1	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271855	272133	.	-	.	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	start_codon	272056	272058	.	-	0	transcript_id "g45.t2"; gene_id "g45";
NW_003724208.1	AUGUSTUS	tss	272133	272133	.	-	.	transcript_id "g45.t2"; gene_id "g45";
# coding sequence = [atggctctccagtctttcgtcgaagttcaccctgactctcacttccccatccagaaccttccgtacggtgttttccggc
# ctggaccgtctgcggaggctcggcctggcgtggcgatcggagactatgtgttggatctctcggtggttcagtccgccggtctgttcgacggtccgatt
# gtcggaaaatccgattgtttcctgcagccgaatctcaacaagttcttgggaatgaggcggcctgcatggaaggaagctcgatcgacacttcaaaagct
# gctgtcatctacagaaccaacactgcgtgacaatgcaagcttgagggaaaaagcacttgtaccaatgaacaaggtagaaatgtgtcttcctatggtga
# taggggactattcagacttcttttcgtccatgcatcatgcaaggaactgtgggagcatatttcgtggaccagaggacccgattggagcaaactggttc
# caccttcctattgcttatcatgggcgggcatcgtctattgttatatctggaactgatcttattcggccaaaaggccaaggtcatccaattggcaattc
# accatattttggaccttcaagaaagctagactttgagctagaaatggctgctatagttggtcctggtaatgaattaggaaagcctgtggatgttaatg
# aggctgcagatcatatctttggacttgtgatcatgaatgactggagtgcaagagatattcaggcatgggaatatgtgcctcttgggccttttcttggg
# aagagttttggtacaacactatccccttggattgtgacccttgatgctctagagccctttgcttgtgatgctccaaaacaggaccctcctcccttgcc
# gtatctggctgaaaaaatatcccaaaactatgacatttccttagaggttgggattaaacctgctggacataaaaattcgtgcattgtcacaaggagta
# acttaaagcacttatattggacactgactcaacaacttgcacaccatacaatcaatggttgcaacttaaggccaggcgatctccttggaactggaacc
# ataagtggacctgaaccggaatctttgggatgcttgctagaattaacatggaatggacaaaagccagtatctttggatggaacaacccgtggatttct
# tgaagatggagatgaagtcactatcactggttattgcaagagcaaaaccattaattctgaatctgtgcgggcaatggttacaaagttgggttcggaac
# atgctcaggcaagattcttccatcatctccttgaggaaaatgttggccctggtgatcagaataagtgctcgtttctcactttacctcaaacttgggtt
# gaacaattgtag]
# protein sequence = [MALQSFVEVHPDSHFPIQNLPYGVFRPGPSAEARPGVAIGDYVLDLSVVQSAGLFDGPIVGKSDCFLQPNLNKFLGMR
# RPAWKEARSTLQKLLSSTEPTLRDNASLREKALVPMNKVEMCLPMVIGDYSDFFSSMHHARNCGSIFRGPEDPIGANWFHLPIAYHGRASSIVISGTD
# LIRPKGQGHPIGNSPYFGPSRKLDFELEMAAIVGPGNELGKPVDVNEAADHIFGLVIMNDWSARDIQAWEYVPLGPFLGKSFGTTLSPWIVTLDALEP
# FACDAPKQDPPPLPYLAEKISQNYDISLEVGIKPAGHKNSCIVTRSNLKHLYWTLTQQLAHHTINGCNLRPGDLLGTGTISGPEPESLGCLLELTWNG
# QKPVSLDGTTRGFLEDGDEVTITGYCKSKTINSESVRAMVTKLGSEHAQARFFHHLLEENVGPGDQNKCSFLTLPQTWVEQL]
NW_003724208.1	AUGUSTUS	transcript	265956	272143	0.01	-	.	g45.t3
NW_003724208.1	AUGUSTUS	tts	265956	265956	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	265956	266791	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	stop_codon	266146	266148	.	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	terminal	266146	266791	0.12	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	267354	267488	0.07	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	267616	267644	0.29	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268106	268231	0.46	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268374	268470	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	268970	269034	0.99	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269270	269332	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269463	269533	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269630	269689	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	269775	269874	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270045	270117	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270611	270685	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	270799	270923	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271009	271067	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	internal	271252	271330	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	initial	271855	272058	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	266792	267353	0.05	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	267489	267615	0.52	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	267645	268105	0.29	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268232	268373	0.67	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	268471	268969	0.97	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269035	269269	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269333	269462	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269534	269629	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269690	269774	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	269875	270044	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270118	270610	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270686	270798	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	270924	271008	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271068	271251	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	intron	271331	271854	1	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	266146	266791	0.12	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	267354	267488	0.07	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	267354	267488	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	267616	267644	0.29	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	267616	267644	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268106	268231	0.46	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268106	268231	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268374	268470	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268374	268470	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	268970	269034	0.99	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	268970	269034	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269270	269332	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269270	269332	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269463	269533	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269463	269533	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269630	269689	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269630	269689	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	269775	269874	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	269775	269874	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270045	270117	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270045	270117	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270611	270685	1	-	1	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270611	270685	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	270799	270923	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	270799	270923	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271009	271067	1	-	2	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271009	271067	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271252	271330	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271252	271330	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	271855	272058	1	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	271855	272143	.	-	.	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	start_codon	272056	272058	.	-	0	transcript_id "g45.t3"; gene_id "g45";
NW_003724208.1	AUGUSTUS	tss	272143	272143	.	-	.	transcript_id "g45.t3"; gene_id "g45";
# coding sequence = [atggctctccagtctttcgtcgaagttcaccctgactctcacttccccatccagaaccttccgtacggtgttttccggc
# ctggaccgtctgcggaggctcggcctggcgtggcgatcggagactatgtgttggatctctcggtggttcagtccgccggtctgttcgacggtccgatt
# gtcggaaaatccgattgtttcctgcagccgaatctcaacaagttcttgggaatgaggcggcctgcatggaaggaagctcgatcgacacttcaaaagct
# gctgtcatctacagaaccaacactgcgtgacaatgcaagcttgagggaaaaagcacttgtaccaatgaacaaggtagaaatgtgtcttcctatggtga
# taggggactattcagacttcttttcgtccatgcatcatgcaaggaactgtgggagcatatttcgtggaccagaggacccgattggagcaaactggttc
# caccttcctattgcttatcatgggcgggcatcgtctattgttatatctggaactgatcttattcggccaaaaggccaaggtcatccaattggcaattc
# accatattttggaccttcaagaaagctagactttgagctagaaatggctgctatagttggtcctggtaatgaattaggaaagcctgtggatgttaatg
# aggctgcagatcatatctttggacttgtgatcatgaatgactggagtgcaagagatattcaggcatgggaatatgtgcctcttgggccttttcttggg
# aagagttttggtacaacactatccccttggattgtgacccttgatgctctagagccctttgcttgtgatgctccaaaacaggaccctcctcccttgcc
# gtatctggctgaaaaaatatcccaaaactatgacatttccttagaggttgggattaaacctgctggacataaaaattcgtgcattgtcacaaggagta
# acttaaagcacttatattggacactgactcaacaacttgcacaccatacaatcaatggttgcaacttaaggccaggcgatctccttggaactggaacc
# ataagtggacctgaaccggaatctttgggatgcttgctagaattaacatggaatggacaaaagccagtatctttggatggaacaacccgtggatttct
# tgaagatggagatgaagtcactatcactggttattgcaagagcaaaaccattaattctgaatctgtgcgggcaatggttacaaagttgggttcggaac
# atgctcaggcaagattcttccatcatctccttgaggaaaatgttggccctggtgatcagaataagtgctcgtttctcactttacctcaaacttgggtt
# gaacaattattcagcttcttctcctcctcctcctcctcctcctcctcctcttcctccataaccaccactacagtgatatacactttccgtgacgacca
# aactacccctcatccccaatccaatgaaattcccatccattcctcacccgaaccccccatccccatcaccatccacctccctcaaccgtcggaatccg
# ccgccgccgtagccatccaatccgcctaccgcgcccacctgatccgcactcttgtccggaaaatctccgccgtgagctccgaggccgaccacctgcag
# cgcctaatccagcggcaggaaaccgtggacgccatccggagcgacgatcgcgagaagctgaagatgaacgaggccttgatggctctgctcctgaagct
# cgactccgtgccggggcttgatccggcagtgcgggacctccggaggtccgtgagccgtcggatcgttgggatgcaggagattctagactcggtttccg
# acatcagaacggacggatgggatggattcttgtggaattgggacaaggccatagatgagatggaagaagaagtttgtaaagagagaggcggggatgaa
# atggagaggttttgtgcagagcatttagggttccggtgcctccagaggtttctccgagaggcatag]
# protein sequence = [MALQSFVEVHPDSHFPIQNLPYGVFRPGPSAEARPGVAIGDYVLDLSVVQSAGLFDGPIVGKSDCFLQPNLNKFLGMR
# RPAWKEARSTLQKLLSSTEPTLRDNASLREKALVPMNKVEMCLPMVIGDYSDFFSSMHHARNCGSIFRGPEDPIGANWFHLPIAYHGRASSIVISGTD
# LIRPKGQGHPIGNSPYFGPSRKLDFELEMAAIVGPGNELGKPVDVNEAADHIFGLVIMNDWSARDIQAWEYVPLGPFLGKSFGTTLSPWIVTLDALEP
# FACDAPKQDPPPLPYLAEKISQNYDISLEVGIKPAGHKNSCIVTRSNLKHLYWTLTQQLAHHTINGCNLRPGDLLGTGTISGPEPESLGCLLELTWNG
# QKPVSLDGTTRGFLEDGDEVTITGYCKSKTINSESVRAMVTKLGSEHAQARFFHHLLEENVGPGDQNKCSFLTLPQTWVEQLFSFFSSSSSSSSSSSS
# ITTTTVIYTFRDDQTTPHPQSNEIPIHSSPEPPIPITIHLPQPSESAAAVAIQSAYRAHLIRTLVRKISAVSSEADHLQRLIQRQETVDAIRSDDREK
# LKMNEALMALLLKLDSVPGLDPAVRDLRRSVSRRIVGMQEILDSVSDIRTDGWDGFLWNWDKAIDEMEEEVCKERGGDEMERFCAEHLGFRCLQRFLR
# EA]
NW_003724208.1	AUGUSTUS	transcript	265956	266923	0.07	-	.	g45.t4
NW_003724208.1	AUGUSTUS	tts	265956	265956	.	-	.	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	exon	265956	266923	.	-	.	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	stop_codon	266146	266148	.	-	0	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	single	266146	266808	0.73	-	0	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	CDS	266146	266808	0.73	-	0	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	start_codon	266806	266808	.	-	0	transcript_id "g45.t4"; gene_id "g45";
NW_003724208.1	AUGUSTUS	tss	266923	266923	.	-	.	transcript_id "g45.t4"; gene_id "g45";
# coding sequence = [atgaaaccctctcgcagattcagcttcttctcctcctcctcctcctcctcctcctcctcttcctccataaccaccacta
# cagtgatatacactttccgtgacgaccaaactacccctcatccccaatccaatgaaattcccatccattcctcacccgaaccccccatccccatcacc
# atccacctccctcaaccgtcggaatccgccgccgccgtagccatccaatccgcctaccgcgcccacctgatccgcactcttgtccggaaaatctccgc
# cgtgagctccgaggccgaccacctgcagcgcctaatccagcggcaggaaaccgtggacgccatccggagcgacgatcgcgagaagctgaagatgaacg
# aggccttgatggctctgctcctgaagctcgactccgtgccggggcttgatccggcagtgcgggacctccggaggtccgtgagccgtcggatcgttggg
# atgcaggagattctagactcggtttccgacatcagaacggacggatgggatggattcttgtggaattgggacaaggccatagatgagatggaagaaga
# agtttgtaaagagagaggcggggatgaaatggagaggttttgtgcagagcatttagggttccggtgcctccagaggtttctccgagaggcatag]
# protein sequence = [MKPSRRFSFFSSSSSSSSSSSSITTTTVIYTFRDDQTTPHPQSNEIPIHSSPEPPIPITIHLPQPSESAAAVAIQSAY
# RAHLIRTLVRKISAVSSEADHLQRLIQRQETVDAIRSDDREKLKMNEALMALLLKLDSVPGLDPAVRDLRRSVSRRIVGMQEILDSVSDIRTDGWDGF
# LWNWDKAIDEMEEEVCKERGGDEMERFCAEHLGFRCLQRFLREA]
# end gene g45
###
# start gene g46
NW_003724208.1	AUGUSTUS	gene	276808	278404	0.16	+	.	g46
NW_003724208.1	AUGUSTUS	transcript	276808	278404	0.16	+	.	g46.t1
NW_003724208.1	AUGUSTUS	tss	276808	276808	.	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	exon	276808	277130	.	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	start_codon	276992	276994	.	+	0	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	initial	276992	277130	0.66	+	0	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	internal	277216	277279	0.86	+	2	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	terminal	277368	277455	0.89	+	1	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	intron	277131	277215	0.72	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	intron	277280	277367	0.91	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	CDS	276992	277130	0.66	+	0	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	CDS	277216	277279	0.86	+	2	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	exon	277216	277279	.	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	CDS	277368	277455	0.89	+	1	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	exon	277368	277475	.	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	stop_codon	277453	277455	.	+	0	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	exon	278220	278404	.	+	.	transcript_id "g46.t1"; gene_id "g46";
NW_003724208.1	AUGUSTUS	tts	278404	278404	.	+	.	transcript_id "g46.t1"; gene_id "g46";
# coding sequence = [atgggtattgttgatgccttgcgtctcgggtatcctcgcagttgccaactggacgtttgctttcaaccaaggatgattt
# atggctcagtcaatcctacaaaagatgtcctgacagggtgtccggacacaccctccgatgtgtcagaagttttgcctccctttaatggtgggacaact
# ttttggcttgtcatgatggcattgaggcggcggaatgcggactgtgataggctgtctgaggtgactcagcatggcctgcgttttatggccaaggatct
# agacaacatatcctga]
# protein sequence = [MGIVDALRLGYPRSCQLDVCFQPRMIYGSVNPTKDVLTGCPDTPSDVSEVLPPFNGGTTFWLVMMALRRRNADCDRLS
# EVTQHGLRFMAKDLDNIS]
# end gene g46
###
# start gene g47
NW_003724208.1	AUGUSTUS	gene	279368	280429	0.03	+	.	g47
NW_003724208.1	AUGUSTUS	transcript	279368	280429	0.03	+	.	g47.t1
NW_003724208.1	AUGUSTUS	tss	279368	279368	.	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	exon	279368	279708	.	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	start_codon	279538	279540	.	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	initial	279538	279708	0.66	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	internal	279936	280094	0.82	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	terminal	280358	280378	0.62	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	intron	279709	279935	0.66	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	intron	280095	280357	0.58	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	CDS	279538	279708	0.66	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	CDS	279936	280094	0.82	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	exon	279936	280094	.	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	CDS	280358	280378	0.62	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	exon	280358	280429	.	+	.	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	stop_codon	280376	280378	.	+	0	transcript_id "g47.t1"; gene_id "g47";
NW_003724208.1	AUGUSTUS	tts	280429	280429	.	+	.	transcript_id "g47.t1"; gene_id "g47";
# coding sequence = [atgtcgtttgatctgatgttgaagccctcatgcagcggctgtggatccaccacggatttgtacggaagcaactgcaagc
# acatgactctctgcttgtcgtgtggcaaaaccatggcagagaaccacgggaaatgctacgactgtggcacccctgtcactcgattgattagggaatac
# aatgttcggacgaattccagcggcgataagaattacttcattggtaggtttgtgactggtttgccgggtttttcaaagaagaaaaatgctgataataa
# atggtctctgcataaagaggggcttcaaggacgccaagtttctgatgctttgcggtgtcttcttttacatgcctaa]
# protein sequence = [MSFDLMLKPSCSGCGSTTDLYGSNCKHMTLCLSCGKTMAENHGKCYDCGTPVTRLIREYNVRTNSSGDKNYFIGRFVT
# GLPGFSKKKNADNKWSLHKEGLQGRQVSDALRCLLLHA]
# end gene g47
###
# start gene g48
NW_003724208.1	AUGUSTUS	gene	284102	289463	0.02	-	.	g48
NW_003724208.1	AUGUSTUS	transcript	284102	289463	0.01	-	.	g48.t1
NW_003724208.1	AUGUSTUS	tts	284102	284102	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	284102	284969	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	stop_codon	284571	284573	.	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	terminal	284571	284969	0.45	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285054	285202	0.47	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285314	285412	0.58	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285524	286647	0.69	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	286817	286972	0.47	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287077	287160	0.48	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287262	287439	0.47	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287599	287752	0.76	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287884	288341	0.62	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	288422	288666	0.73	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	initial	288768	288955	0.58	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	284970	285053	0.5	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	285203	285313	0.67	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	285413	285523	0.75	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	286648	286816	0.81	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	286973	287076	0.48	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287161	287261	0.49	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287440	287598	0.78	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287753	287883	0.86	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	288342	288421	0.63	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	288667	288767	0.73	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	284571	284969	0.45	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285054	285202	0.47	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285054	285202	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285314	285412	0.58	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285314	285412	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285524	286647	0.69	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285524	286647	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	286817	286972	0.47	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	286817	286972	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287077	287160	0.48	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287077	287160	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287262	287439	0.47	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287262	287439	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287599	287752	0.76	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287599	287752	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287884	288341	0.62	-	2	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287884	288341	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	288422	288666	0.73	-	1	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	288422	288666	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	288768	288955	0.58	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	288768	289180	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	start_codon	288953	288955	.	-	0	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	289347	289463	.	-	.	transcript_id "g48.t1"; gene_id "g48";
NW_003724208.1	AUGUSTUS	tss	289463	289463	.	-	.	transcript_id "g48.t1"; gene_id "g48";
# coding sequence = [atgggcaacgagcgagaggttagggatgaaggaaaaggagactcacgcgttggtttcaaaatggcgaatgtacagacgc
# atggagaacctgcaaaagtggacgtgccgtgtgaaaatggtgaaaggggatgcagaaaggcagctgcgttctctgaagcgatgtcggaaaaagtagca
# gatggtgacaggcccgcggaggagggccaagtgactgaaggccacaaagaattaatggaaatgggccggcccaagtctttaccctataaaggccctga
# ggtggtgatggaacgatccattgaggctagggctcccgacaggggactgggcgtcagtggagagcttgagagggaaatgataggctctcagatggggt
# cgcgttcaccggccgtcaatctcacagagttcaccaacgaagccttgctggaggatccaaatggggaaagtgtagccatggctggggtcttcaatcag
# agcagtagctcgaatgaagttgggggagcagttatgggtcctttaaggatgatatgggcggatgggagggaggccgaggtattgcaaatggcgggtag
# ggaagcaggggttttcggagagaaatcagagggggttacggataggatcctccatgaggatatggaggagagggaagaagagggggaaccttgttggc
# aatctagtagtttggctaagtttagccgctatattggaatgccgacggagggattcgaaagggaaattttgttattactgaaaagaatgaaagaaagg
# aagattcagaaaggaaaattagaccgcaaaaaaaggaaaaaattgaagtcgtcaaaatttgaaagagaattgagaaaattggaatggatagtgaacta
# tattggagaagaaggaggagaagaaggggaaactaagatccaagacatgtcaaagggtattattcgcagcctaggggtgggaagatatcttgactggg
# gggcagtggattcaagaggggcagttggtggtatagtggtgttttgggacaacagagtattggacttggttgatattcaaaaaggggattttaatgcc
# atcctaagtcctaaagagcgcaacagaggggggagcctgaattcgaacatgagaaggttcttagaaattatagaagacttagagttaaaggatgtgcc
# tttagtcgggggcccttttacttggaacggaggggtgaataatcagaccttcttaaggctggatagggggtgtgagaagaggcccttcccttttagat
# ttgaaaacatgtggttgaaagtggaaggtgttaaggagcttatgaagtcttggattgagctcagaaaaaatgcggcgttggagcaggtgcagttttgg
# gatgcaaaggagaaaattagcagactgaatttggaagagctggaagctagggaagattataaaaaatgggttttacttgaagaaatcaattggggcaa
# aaatctagggaattcgggggattggcgtccttctatatccgggctgcagttagagactctggatcagttggatgctagtactttggagagcccgttca
# cggaagaggaggtgttcaatgccttgttgagttgcaatggggataaagctccggggccagatggattctctatggctttctggcaatttgcttgggat
# ttcgtgaaggcggatgtgttgtgttttttcaaggagttctatgaaaatggaaaatttgttaaaagcctaaatgcaactttttttgtcttaattccaaa
# aaaagtgggagctgaagacttgggggattttaggcctataagcttggtgggaagcttgtataagtggttggccaaggtcttagccaataggctaaaaa
# aggtggttggaaaggtgatctccaaggctcaaggggcgtttgtggaaggaagacaaatcctagacgcaatgttgatagccaatgaagccattgattcg
# actctgaaaaataatgagagtgtcatcttatgcaaattggatatagagaaggcttatgataatgtggattggacttttattctcacagttatgcagaa
# aatgggttttggggagaaatggatcaggtggattaaatggtgcatctccactgcaagtttttctgtgttggtcaatggaacccctacaggttttttcc
# aaagctcaaagggattaaggcagggtgatcccttttccccttatctctttgttatagcaatggaggtttttagcgtttttctcaaaagggctgtagag
# ggaggctatttatcggggtgtagggtcaaggggaggagtgaagaaggggtccttatatcccatttgttgttcgccgatgatactctggtgttttgtaa
# tccgtctcaagaccacttgacttatcttagttggttacttatgtggttcgaggccacttcgggattgagaataaatttggaaaaaagtgaactcattc
# ctgtaggaagggtagagaatatggatgaccttgcttgggagtttggttgcaaagtgggtagcttgccgtccacatatttggggatgcccttgggggct
# tctttcaaatcaacatcagtttgggatggagtggaagatcgattccgtaaaaggctagtcaaacggagattagaaaagattcaaagggacttcctttg
# gggtgggggtaatttggagcgaaagcctcatctagtaagatgggaggtggtgtgcttaatgattagagggaaatatgaagaagagagagggggttggt
# cctctcgggaagtgagagaggctcatggcttggggttgtggaaagggataaggatggattgggaattagtgagcaataggttggtcttcattgttggt
# aatgggaggagggaagaaagtgtggcagatgtttgggactccttggcggaggggggatgggggggttggaatccatgctttttaagagctttcaatga
# ttgggaggtagaggaagcgtcaagttttatggagcggttacatcgtaacagagttattgaggatgtggaggacatggtatcctggactgaaactaaga
# gtggtaaattctcggttaaatctctatacttggcccttgaagcggggtgttcgactcggtttccttcaagccttatttggaatgagaatgtgcagccc
# aagattagtttttttgcatgggaggctacgtggggcaaagcactaaccttggacaaggtgcaaaaaagaggatgggctttggcaaatagatgtttttt
# gtgtcttgagaatgagtag]
# protein sequence = [MGNEREVRDEGKGDSRVGFKMANVQTHGEPAKVDVPCENGERGCRKAAAFSEAMSEKVADGDRPAEEGQVTEGHKELM
# EMGRPKSLPYKGPEVVMERSIEARAPDRGLGVSGELEREMIGSQMGSRSPAVNLTEFTNEALLEDPNGESVAMAGVFNQSSSSNEVGGAVMGPLRMIW
# ADGREAEVLQMAGREAGVFGEKSEGVTDRILHEDMEEREEEGEPCWQSSSLAKFSRYIGMPTEGFEREILLLLKRMKERKIQKGKLDRKKRKKLKSSK
# FERELRKLEWIVNYIGEEGGEEGETKIQDMSKGIIRSLGVGRYLDWGAVDSRGAVGGIVVFWDNRVLDLVDIQKGDFNAILSPKERNRGGSLNSNMRR
# FLEIIEDLELKDVPLVGGPFTWNGGVNNQTFLRLDRGCEKRPFPFRFENMWLKVEGVKELMKSWIELRKNAALEQVQFWDAKEKISRLNLEELEARED
# YKKWVLLEEINWGKNLGNSGDWRPSISGLQLETLDQLDASTLESPFTEEEVFNALLSCNGDKAPGPDGFSMAFWQFAWDFVKADVLCFFKEFYENGKF
# VKSLNATFFVLIPKKVGAEDLGDFRPISLVGSLYKWLAKVLANRLKKVVGKVISKAQGAFVEGRQILDAMLIANEAIDSTLKNNESVILCKLDIEKAY
# DNVDWTFILTVMQKMGFGEKWIRWIKWCISTASFSVLVNGTPTGFFQSSKGLRQGDPFSPYLFVIAMEVFSVFLKRAVEGGYLSGCRVKGRSEEGVLI
# SHLLFADDTLVFCNPSQDHLTYLSWLLMWFEATSGLRINLEKSELIPVGRVENMDDLAWEFGCKVGSLPSTYLGMPLGASFKSTSVWDGVEDRFRKRL
# VKRRLEKIQRDFLWGGGNLERKPHLVRWEVVCLMIRGKYEEERGGWSSREVREAHGLGLWKGIRMDWELVSNRLVFIVGNGRREESVADVWDSLAEGG
# WGGWNPCFLRAFNDWEVEEASSFMERLHRNRVIEDVEDMVSWTETKSGKFSVKSLYLALEAGCSTRFPSSLIWNENVQPKISFFAWEATWGKALTLDK
# VQKRGWALANRCFLCLENE]
NW_003724208.1	AUGUSTUS	transcript	284102	289313	0.01	-	.	g48.t2
NW_003724208.1	AUGUSTUS	tts	284102	284102	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	284102	284969	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	stop_codon	284571	284573	.	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	terminal	284571	284969	0.45	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285054	285202	0.47	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285314	285412	0.58	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	285524	286647	0.69	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	286817	286972	0.47	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287077	287160	0.48	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287262	287439	0.47	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287599	287752	0.76	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	287884	288341	0.62	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	288422	288666	0.73	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	internal	288768	288962	0.16	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	initial	289035	289204	0.16	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	284970	285053	0.5	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	285203	285313	0.67	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	285413	285523	0.75	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	286648	286816	0.81	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	286973	287076	0.48	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287161	287261	0.49	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287440	287598	0.78	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	287753	287883	0.86	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	288342	288421	0.63	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	288667	288767	0.73	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	intron	288963	289034	0.16	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	284571	284969	0.45	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285054	285202	0.47	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285054	285202	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285314	285412	0.58	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285314	285412	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	285524	286647	0.69	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	285524	286647	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	286817	286972	0.47	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	286817	286972	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287077	287160	0.48	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287077	287160	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287262	287439	0.47	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287262	287439	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287599	287752	0.76	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287599	287752	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	287884	288341	0.62	-	2	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	287884	288341	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	288422	288666	0.73	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	288422	288666	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	288768	288962	0.16	-	1	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	288768	288962	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	CDS	289035	289204	0.16	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	exon	289035	289313	.	-	.	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	start_codon	289202	289204	.	-	0	transcript_id "g48.t2"; gene_id "g48";
NW_003724208.1	AUGUSTUS	tss	289313	289313	.	-	.	transcript_id "g48.t2"; gene_id "g48";
# coding sequence = [atgccgttgcatttttggagccaggagatactcagaaaaatcaatgattgttgcggggggttcctcgcagtggatgaag
# acactgcaaaatttaaggaattaaaatgggccagactattagtgagatcggaaggcttagagtggccgagctcattgcaagtggcagttggaaacgag
# atgggcaacgagcgagaggttagggatgaaggaaaaggagactcacgcgttggtttcaaaatggcgaatgtacagacgcatggagaacctgcaaaagt
# ggacgtgccgtgtgaaaatggtgaaaggggatgcagaaaggcagctgcgttctctgaagcgatgtcggaaaaagtagcagatggtgacaggcccgcgg
# aggagggccaagtgactgaaggccacaaagaattaatggaaatgggccggcccaagtctttaccctataaaggccctgaggtggtgatggaacgatcc
# attgaggctagggctcccgacaggggactgggcgtcagtggagagcttgagagggaaatgataggctctcagatggggtcgcgttcaccggccgtcaa
# tctcacagagttcaccaacgaagccttgctggaggatccaaatggggaaagtgtagccatggctggggtcttcaatcagagcagtagctcgaatgaag
# ttgggggagcagttatgggtcctttaaggatgatatgggcggatgggagggaggccgaggtattgcaaatggcgggtagggaagcaggggttttcgga
# gagaaatcagagggggttacggataggatcctccatgaggatatggaggagagggaagaagagggggaaccttgttggcaatctagtagtttggctaa
# gtttagccgctatattggaatgccgacggagggattcgaaagggaaattttgttattactgaaaagaatgaaagaaaggaagattcagaaaggaaaat
# tagaccgcaaaaaaaggaaaaaattgaagtcgtcaaaatttgaaagagaattgagaaaattggaatggatagtgaactatattggagaagaaggagga
# gaagaaggggaaactaagatccaagacatgtcaaagggtattattcgcagcctaggggtgggaagatatcttgactggggggcagtggattcaagagg
# ggcagttggtggtatagtggtgttttgggacaacagagtattggacttggttgatattcaaaaaggggattttaatgccatcctaagtcctaaagagc
# gcaacagaggggggagcctgaattcgaacatgagaaggttcttagaaattatagaagacttagagttaaaggatgtgcctttagtcgggggccctttt
# acttggaacggaggggtgaataatcagaccttcttaaggctggatagggggtgtgagaagaggcccttcccttttagatttgaaaacatgtggttgaa
# agtggaaggtgttaaggagcttatgaagtcttggattgagctcagaaaaaatgcggcgttggagcaggtgcagttttgggatgcaaaggagaaaatta
# gcagactgaatttggaagagctggaagctagggaagattataaaaaatgggttttacttgaagaaatcaattggggcaaaaatctagggaattcgggg
# gattggcgtccttctatatccgggctgcagttagagactctggatcagttggatgctagtactttggagagcccgttcacggaagaggaggtgttcaa
# tgccttgttgagttgcaatggggataaagctccggggccagatggattctctatggctttctggcaatttgcttgggatttcgtgaaggcggatgtgt
# tgtgttttttcaaggagttctatgaaaatggaaaatttgttaaaagcctaaatgcaactttttttgtcttaattccaaaaaaagtgggagctgaagac
# ttgggggattttaggcctataagcttggtgggaagcttgtataagtggttggccaaggtcttagccaataggctaaaaaaggtggttggaaaggtgat
# ctccaaggctcaaggggcgtttgtggaaggaagacaaatcctagacgcaatgttgatagccaatgaagccattgattcgactctgaaaaataatgaga
# gtgtcatcttatgcaaattggatatagagaaggcttatgataatgtggattggacttttattctcacagttatgcagaaaatgggttttggggagaaa
# tggatcaggtggattaaatggtgcatctccactgcaagtttttctgtgttggtcaatggaacccctacaggttttttccaaagctcaaagggattaag
# gcagggtgatcccttttccccttatctctttgttatagcaatggaggtttttagcgtttttctcaaaagggctgtagagggaggctatttatcggggt
# gtagggtcaaggggaggagtgaagaaggggtccttatatcccatttgttgttcgccgatgatactctggtgttttgtaatccgtctcaagaccacttg
# acttatcttagttggttacttatgtggttcgaggccacttcgggattgagaataaatttggaaaaaagtgaactcattcctgtaggaagggtagagaa
# tatggatgaccttgcttgggagtttggttgcaaagtgggtagcttgccgtccacatatttggggatgcccttgggggcttctttcaaatcaacatcag
# tttgggatggagtggaagatcgattccgtaaaaggctagtcaaacggagattagaaaagattcaaagggacttcctttggggtgggggtaatttggag
# cgaaagcctcatctagtaagatgggaggtggtgtgcttaatgattagagggaaatatgaagaagagagagggggttggtcctctcgggaagtgagaga
# ggctcatggcttggggttgtggaaagggataaggatggattgggaattagtgagcaataggttggtcttcattgttggtaatgggaggagggaagaaa
# gtgtggcagatgtttgggactccttggcggaggggggatgggggggttggaatccatgctttttaagagctttcaatgattgggaggtagaggaagcg
# tcaagttttatggagcggttacatcgtaacagagttattgaggatgtggaggacatggtatcctggactgaaactaagagtggtaaattctcggttaa
# atctctatacttggcccttgaagcggggtgttcgactcggtttccttcaagccttatttggaatgagaatgtgcagcccaagattagtttttttgcat
# gggaggctacgtggggcaaagcactaaccttggacaaggtgcaaaaaagaggatgggctttggcaaatagatgttttttgtgtcttgagaatgagtag]
# protein sequence = [MPLHFWSQEILRKINDCCGGFLAVDEDTAKFKELKWARLLVRSEGLEWPSSLQVAVGNEMGNEREVRDEGKGDSRVGF
# KMANVQTHGEPAKVDVPCENGERGCRKAAAFSEAMSEKVADGDRPAEEGQVTEGHKELMEMGRPKSLPYKGPEVVMERSIEARAPDRGLGVSGELERE
# MIGSQMGSRSPAVNLTEFTNEALLEDPNGESVAMAGVFNQSSSSNEVGGAVMGPLRMIWADGREAEVLQMAGREAGVFGEKSEGVTDRILHEDMEERE
# EEGEPCWQSSSLAKFSRYIGMPTEGFEREILLLLKRMKERKIQKGKLDRKKRKKLKSSKFERELRKLEWIVNYIGEEGGEEGETKIQDMSKGIIRSLG
# VGRYLDWGAVDSRGAVGGIVVFWDNRVLDLVDIQKGDFNAILSPKERNRGGSLNSNMRRFLEIIEDLELKDVPLVGGPFTWNGGVNNQTFLRLDRGCE
# KRPFPFRFENMWLKVEGVKELMKSWIELRKNAALEQVQFWDAKEKISRLNLEELEAREDYKKWVLLEEINWGKNLGNSGDWRPSISGLQLETLDQLDA
# STLESPFTEEEVFNALLSCNGDKAPGPDGFSMAFWQFAWDFVKADVLCFFKEFYENGKFVKSLNATFFVLIPKKVGAEDLGDFRPISLVGSLYKWLAK
# VLANRLKKVVGKVISKAQGAFVEGRQILDAMLIANEAIDSTLKNNESVILCKLDIEKAYDNVDWTFILTVMQKMGFGEKWIRWIKWCISTASFSVLVN
# GTPTGFFQSSKGLRQGDPFSPYLFVIAMEVFSVFLKRAVEGGYLSGCRVKGRSEEGVLISHLLFADDTLVFCNPSQDHLTYLSWLLMWFEATSGLRIN
# LEKSELIPVGRVENMDDLAWEFGCKVGSLPSTYLGMPLGASFKSTSVWDGVEDRFRKRLVKRRLEKIQRDFLWGGGNLERKPHLVRWEVVCLMIRGKY
# EEERGGWSSREVREAHGLGLWKGIRMDWELVSNRLVFIVGNGRREESVADVWDSLAEGGWGGWNPCFLRAFNDWEVEEASSFMERLHRNRVIEDVEDM
# VSWTETKSGKFSVKSLYLALEAGCSTRFPSSLIWNENVQPKISFFAWEATWGKALTLDKVQKRGWALANRCFLCLENE]
# end gene g48
###
# start gene g49
NW_003724208.1	AUGUSTUS	gene	290898	296505	0.14	+	.	g49
NW_003724208.1	AUGUSTUS	transcript	290898	296505	0.14	+	.	g49.t1
NW_003724208.1	AUGUSTUS	tss	290898	290898	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	290898	290944	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	start_codon	290927	290929	.	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	initial	290927	290944	1	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	291125	291270	0.98	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	291556	291932	0.86	+	1	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	294512	294627	0.97	+	2	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	294832	294966	1	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	295154	295366	0.9	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	internal	295490	295702	0.99	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	terminal	296221	296310	0.85	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	290945	291124	0.98	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	291271	291555	1	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	291933	294511	0.83	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	294628	294831	0.97	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	294967	295153	1	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	295367	295489	0.9	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	intron	295703	296220	0.81	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	290927	290944	1	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	291125	291270	0.98	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	291125	291270	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	291556	291932	0.86	+	1	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	291556	291932	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	294512	294627	0.97	+	2	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	294512	294627	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	294832	294966	1	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	294832	294966	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	295154	295366	0.9	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	295154	295366	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	295490	295702	0.99	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	295490	295702	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	CDS	296221	296310	0.85	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	exon	296221	296505	.	+	.	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	stop_codon	296308	296310	.	+	0	transcript_id "g49.t1"; gene_id "g49";
NW_003724208.1	AUGUSTUS	tts	296505	296505	.	+	.	transcript_id "g49.t1"; gene_id "g49";
# coding sequence = [atgcaaccaatttggctggagaagtacaagaataaaccttggctcttggaggatgaaacaggtcaatatcagtatcatg
# gtcagcttgagggttcacaatcagcaacttactacctactaatgatgcaaggaaaggaatttgttgctattccagctggatcttggtacaactttaac
# aaagttgctcagtataagcaactcaccttggaggaagcagaagagaagatgaagaataggaggaggactgcagatggatatcaaagatggatgatgaa
# ggcagcaaataatggacctgctgcatttggtgaagtggagaagcttgatgacaaggagactggtggtgcagctggtggtgggaggggacgtaaaaaac
# aaactggtgatgaagaagaaggtaatgtctcggataaggcagaggaagatgaagaagaagaggcagaaaggaagaacagacttggacttaacaaaaga
# agtggtgatgacgatgaagaaggtccaagaggtggtgatcatgatttagatgatgatgatattgagaagggtgatgattgggagcatgaagaaatttt
# cactgatgacgatgaagctgttggtaatgatcctgaggaacgggaagatttggcacccgaagttcctgcacctccagaaataaagcaggatgaagagg
# acgaagatgattctaatgaagaggagggaggattaagcaaatctggaaaggagttgaaaaaactgcttggaaaagctgctggaatgaatgattcggat
# gcagaggatgacgatgacgatgaagaagaagatgagattggcctttctcctgtgctggctccaaaacagaaggatgtacctaaagaagagcctgctga
# taacagtcctatgaaatcagctactgcttctgctcggtcaacaccacctacttcaaaatcatcaaaagggaagagaaagtcaaatggtgatgacatga
# aaacaactaatggtggacctccaaagaaggtgaagacagaaaatgaatcaaaatcttctgcaaaagatgaaggcccatctccttctaaagttactgca
# actccaaagggaacgccatcatcatctgtgaaaactggatcaacatcgtcagctggaccagtcacagaagatgaaatcagggctgttttattgcagaa
# ggcacctgtgaccactcaggatcttgtcgccaaatttaaagccagactgaaatcccaagaggataagaaggcttttgctgatatactgaggagaatct
# ctaagatacaaaagactaatggacctaactatgttgtgttgagagataaatga]
# protein sequence = [MQPIWLEKYKNKPWLLEDETGQYQYHGQLEGSQSATYYLLMMQGKEFVAIPAGSWYNFNKVAQYKQLTLEEAEEKMKN
# RRRTADGYQRWMMKAANNGPAAFGEVEKLDDKETGGAAGGGRGRKKQTGDEEEGNVSDKAEEDEEEEAERKNRLGLNKRSGDDDEEGPRGGDHDLDDD
# DIEKGDDWEHEEIFTDDDEAVGNDPEEREDLAPEVPAPPEIKQDEEDEDDSNEEEGGLSKSGKELKKLLGKAAGMNDSDAEDDDDDEEEDEIGLSPVL
# APKQKDVPKEEPADNSPMKSATASARSTPPTSKSSKGKRKSNGDDMKTTNGGPPKKVKTENESKSSAKDEGPSPSKVTATPKGTPSSSVKTGSTSSAG
# PVTEDEIRAVLLQKAPVTTQDLVAKFKARLKSQEDKKAFADILRRISKIQKTNGPNYVVLRDK]
# end gene g49
###
# start gene g50
NW_003724208.1	AUGUSTUS	gene	298389	299573	0.13	-	.	g50
NW_003724208.1	AUGUSTUS	transcript	298389	299573	0.13	-	.	g50.t1
NW_003724208.1	AUGUSTUS	tts	298389	298389	.	-	.	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	exon	298389	298880	.	-	.	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	stop_codon	298528	298530	.	-	0	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	terminal	298528	298880	1	-	2	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	initial	299368	299530	0.99	-	0	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	intron	298881	299367	0.99	-	.	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	CDS	298528	298880	1	-	2	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	CDS	299368	299530	0.99	-	0	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	exon	299368	299573	.	-	.	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	start_codon	299528	299530	.	-	0	transcript_id "g50.t1"; gene_id "g50";
NW_003724208.1	AUGUSTUS	tss	299573	299573	.	-	.	transcript_id "g50.t1"; gene_id "g50";
# coding sequence = [atggctggagtgaagatgatcgtggctctgttgctcgtggtctatgtgagttgggtgggagcccagacgcatcacgtcg
# tcggcggcgaccgtggctgggccaagtcctccgaggtcagagactggctgtccgacaaagtgttcagagtcggagacaaaatctggttcatatactcc
# gcagcacaggagggcgttgctgagctcaggagcaaggaggaattcgagtcgtgcgatgtgagcaaccccatcaagatgtacacggacggtctagatag
# cgtacccttggacggagaagggatccgctacttcacgagcagcaagacagagagctgcaaagatggcctgaagctacacgttgatgtccagcccacta
# gtgagatcgggagcgttgccacgtcagagacctttgcagagacgctggctgaggggccctcagcaccttctgctgcggcccacatcagtgcgctttct
# ccactatttttgatgggtctgctgatctgttacttcggcccatga]
# protein sequence = [MAGVKMIVALLLVVYVSWVGAQTHHVVGGDRGWAKSSEVRDWLSDKVFRVGDKIWFIYSAAQEGVAELRSKEEFESCD
# VSNPIKMYTDGLDSVPLDGEGIRYFTSSKTESCKDGLKLHVDVQPTSEIGSVATSETFAETLAEGPSAPSAAAHISALSPLFLMGLLICYFGP]
# end gene g50
###
# start gene g51
NW_003724208.1	AUGUSTUS	gene	307206	308403	0.04	-	.	g51
NW_003724208.1	AUGUSTUS	transcript	307206	308403	0.04	-	.	g51.t1
NW_003724208.1	AUGUSTUS	tts	307206	307206	.	-	.	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	exon	307206	307758	.	-	.	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	stop_codon	307247	307249	.	-	0	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	terminal	307247	307758	1	-	2	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	initial	308189	308351	0.91	-	0	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	intron	307759	308188	0.91	-	.	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	CDS	307247	307758	1	-	2	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	CDS	308189	308351	0.91	-	0	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	exon	308189	308403	.	-	.	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	start_codon	308349	308351	.	-	0	transcript_id "g51.t1"; gene_id "g51";
NW_003724208.1	AUGUSTUS	tss	308403	308403	.	-	.	transcript_id "g51.t1"; gene_id "g51";
# coding sequence = [atggcagaagtgaagctagttgtggctctgttgctcctcgtctatgtgagttgggcgggagccctggtgcaccacgtcg
# tcggcggcgaccgtggctgggacacatcttccgatgtccaggcctggttgtccaacaaagtgttcagagtcggagacaaaatctggttcatatactcc
# ggaggacaggagggcgtagttgagcttaagagcagggaggaattcgattcgtgcgatgtgagcaaccccatcaggacatacacggagggtctagatgc
# tgtattaatgggtagcgaagggattcgctacttcacaagcagtaagccaaagagctgcaaagacggcctgaggctacttgtggaggtccagtccaatc
# gtgagatcaagagcgatgccaagtcagagaccgctacaataacgctggctgctgggcccatatccttttctgttgtagcccccgctgcaacgaccctg
# gctgctgggcccatatccttttctgctggagcccccgctgcaacgaccctggctgctgggcccatatcctctcctgctgtaggccttgctgcaacgac
# cctggctgatgggcccatatcatcttctgcagtagcccccgctgcaacgaccctggctcctgagcccatatcaccttctgctgcaacccatttcactt
# gcacctag]
# protein sequence = [MAEVKLVVALLLLVYVSWAGALVHHVVGGDRGWDTSSDVQAWLSNKVFRVGDKIWFIYSGGQEGVVELKSREEFDSCD
# VSNPIRTYTEGLDAVLMGSEGIRYFTSSKPKSCKDGLRLLVEVQSNREIKSDAKSETATITLAAGPISFSVVAPAATTLAAGPISFSAGAPAATTLAA
# GPISSPAVGLAATTLADGPISSSAVAPAATTLAPEPISPSAATHFTCT]
# end gene g51
###
# start gene g52
NW_003724208.1	AUGUSTUS	gene	310610	311723	0.12	-	.	g52
NW_003724208.1	AUGUSTUS	transcript	310610	311723	0.12	-	.	g52.t1
NW_003724208.1	AUGUSTUS	tts	310610	310610	.	-	.	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	exon	310610	311723	.	-	.	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	stop_codon	310685	310687	.	-	0	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	single	310685	311272	0.92	-	0	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	CDS	310685	311272	0.92	-	0	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	start_codon	311270	311272	.	-	0	transcript_id "g52.t1"; gene_id "g52";
NW_003724208.1	AUGUSTUS	tss	311723	311723	.	-	.	transcript_id "g52.t1"; gene_id "g52";
# coding sequence = [atgggtgcaaagctatgttgtatgagtctgtctacctcagactttaatgagtcaaaaggcattgaaggacatgagcaga
# agccaccaccaaggtcgaccatgctcaacttcaccatcaggcctagatgcatgaagaaagaggaggaggaggagaagaagaagaagaagaagagagat
# catgaccagtggctgccacctgagaagaaatctacgaagatgtgtaatctagcaactctggaggagtggctcttgtcctctccggggatgaagccggc
# cgactccataaccgggggtgagcttcatgttttcaagcagctgtccaaacatagggttcacccatcttcaagtagggtccatgcagagttgatcaccc
# ccagtccaagagacagaataatctcattggagaggattgatgaaggagatcatcatggaggaggaggagagaccttggaggtgggttcctcagtgggc
# agaagcaagagtgggcagctggggagaaaggtgacgtttaggtggccagaggctgatgttatcgtattttactcaccggaggggacttccgaagaaag
# tgatgaacactctccctag]
# protein sequence = [MGAKLCCMSLSTSDFNESKGIEGHEQKPPPRSTMLNFTIRPRCMKKEEEEEKKKKKKRDHDQWLPPEKKSTKMCNLAT
# LEEWLLSSPGMKPADSITGGELHVFKQLSKHRVHPSSSRVHAELITPSPRDRIISLERIDEGDHHGGGGETLEVGSSVGRSKSGQLGRKVTFRWPEAD
# VIVFYSPEGTSEESDEHSP]
# end gene g52
###
# start gene g53
NW_003724208.1	AUGUSTUS	gene	315438	317572	0.11	+	.	g53
NW_003724208.1	AUGUSTUS	transcript	315438	317572	0.11	+	.	g53.t1
NW_003724208.1	AUGUSTUS	tss	315438	315438	.	+	.	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	exon	315438	315644	.	+	.	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	exon	316586	316647	.	+	.	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	start_codon	316592	316594	.	+	0	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	initial	316592	316647	0.62	+	0	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	terminal	316728	316845	0.7	+	1	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	intron	316648	316727	0.62	+	.	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	CDS	316592	316647	0.62	+	0	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	CDS	316728	316845	0.7	+	1	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	exon	316728	317572	.	+	.	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	stop_codon	316843	316845	.	+	0	transcript_id "g53.t1"; gene_id "g53";
NW_003724208.1	AUGUSTUS	tts	317572	317572	.	+	.	transcript_id "g53.t1"; gene_id "g53";
# coding sequence = [atggggaaaagatggagtgaaagaggaaatgaaaggtgtcagttgaagagcagtgggatttccacccaatactttgctt
# tgcttcctcaaggcttaaatcccatattctcttctttatctctgccgcctctttttgcggggtttctctcacactccaagagctctctgggttga]
# protein sequence = [MGKRWSERGNERCQLKSSGISTQYFALLPQGLNPIFSSLSLPPLFAGFLSHSKSSLG]
# end gene g53
###
# start gene g54
NW_003724208.1	AUGUSTUS	gene	318068	322499	0.02	+	.	g54
NW_003724208.1	AUGUSTUS	transcript	318068	322499	0.02	+	.	g54.t1
NW_003724208.1	AUGUSTUS	tss	318068	318068	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	318068	318153	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	319397	319541	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	start_codon	319467	319469	.	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	initial	319467	319541	1	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	internal	320031	320284	0.56	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	internal	320465	320616	0.25	+	1	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	internal	321038	321179	0.25	+	2	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	terminal	321492	321552	0.07	+	1	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	intron	319542	320030	1	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	intron	320285	320464	0.29	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	intron	320617	321037	0.23	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	intron	321180	321491	0.17	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	CDS	319467	319541	1	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	CDS	320031	320284	0.56	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	320031	320284	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	CDS	320465	320616	0.25	+	1	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	320465	320616	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	CDS	321038	321179	0.25	+	2	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	321038	321179	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	CDS	321492	321552	0.07	+	1	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	exon	321492	322499	.	+	.	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	stop_codon	321550	321552	.	+	0	transcript_id "g54.t1"; gene_id "g54";
NW_003724208.1	AUGUSTUS	tts	322499	322499	.	+	.	transcript_id "g54.t1"; gene_id "g54";
# coding sequence = [atgcaaaaggacaacactaccagcgccctgccaacacctgctgcacgtgttcggcagcgtaaacgctcaaatgaggttc
# ctccagaggctagtaaagcaaatggaaaccatcttcttgctgatgatcggaacaaatacaggtctatgtggatccgagcacgctcaacagtctggatg
# attgggggatttgcattaatcatctacatgggtcatctctacatttgggccatggtggttgtcatccaaatctttatggcaagagagctgttctgtct
# actcaggaaaactcatgaagacagtcatctcccaggtttcaggctattaaattggcactttttcttcacagcaatgctatttgtatatggccgcattc
# tcagtcaacggctggtcaatacagtaactcctgacaaattcttatataagcttgtgggcaaccttatcaagtatcatatggttacttgttatttcttg
# tacattgcaggttttatgtggtttattcttacgttaaagaagaagatgtacaagtatcaatttggccagtatgcatggacacacatgattctaattgt
# ggtgtttacccagtctgccttcaccgtggccaacatttttgaaggaattttctggaaggacagggggtcttacaatgttggagggtgtgggccagggt
# gctatttcttaaattag]
# protein sequence = [MQKDNTTSALPTPAARVRQRKRSNEVPPEASKANGNHLLADDRNKYRSMWIRARSTVWMIGGFALIIYMGHLYIWAMV
# VVIQIFMARELFCLLRKTHEDSHLPGFRLLNWHFFFTAMLFVYGRILSQRLVNTVTPDKFLYKLVGNLIKYHMVTCYFLYIAGFMWFILTLKKKMYKY
# QFGQYAWTHMILIVVFTQSAFTVANIFEGIFWKDRGSYNVGGCGPGCYFLN]
# end gene g54
###
# start gene g55
NW_003724208.1	AUGUSTUS	gene	322958	324868	0.17	+	.	g55
NW_003724208.1	AUGUSTUS	transcript	322958	324868	0.09	+	.	g55.t1
NW_003724208.1	AUGUSTUS	tss	322958	322958	.	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	322958	323144	.	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	start_codon	323046	323048	.	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	initial	323046	323144	0.83	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	323233	323319	0.8	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	324073	324201	0.64	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	324309	324365	0.55	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323145	323232	0.99	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323320	324072	0.65	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	324202	324308	0.68	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	324366	324868	0.14	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323046	323144	0.83	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323233	323319	0.8	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	323233	323319	.	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324073	324201	0.64	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324073	324201	.	+	.	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324309	324365	0.55	+	0	transcript_id "g55.t1"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324309	324365	.	+	.	transcript_id "g55.t1"; gene_id "g55";
# coding sequence = [atgcaagcacatcattctaaacccttgtacaataccaacttgttcatgcagcttgcaaatatcatgggtcgttttcagt
# ggctaacatgtccaaggaaggatttatcaactggttggcttcattgtgatcctggtccgttgtttaagccagagtatttcgatttatcaggatgggtt
# cctagatggtttccttggaaggaggtctccattttaccagttcagtggcatgctttatgtgtcggtttgtttgcatcaataatagcaccttttggagg
# attttttgcaagtggctttaaaagagcttttaagatcaaggactttggcgatagtattcctggacacggtggaattactgatagaatggattgtcag]
# protein sequence = [MQAHHSKPLYNTNLFMQLANIMGRFQWLTCPRKDLSTGWLHCDPGPLFKPEYFDLSGWVPRWFPWKEVSILPVQWHAL
# CVGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQ]
NW_003724208.1	AUGUSTUS	transcript	322958	324623	0.05	+	.	g55.t2
NW_003724208.1	AUGUSTUS	tss	322958	322958	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	322958	323144	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	start_codon	323046	323048	.	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	initial	323046	323144	0.83	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	323233	323319	0.8	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	324073	324201	0.64	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	324309	324365	0.55	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	terminal	324515	324562	0.22	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323145	323232	0.99	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323320	324072	0.65	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	324202	324308	0.68	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	324366	324514	0.29	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323046	323144	0.83	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323233	323319	0.8	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	323233	323319	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324073	324201	0.64	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324073	324201	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324309	324365	0.55	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324309	324365	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324515	324562	0.22	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324515	324623	.	+	.	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	stop_codon	324560	324562	.	+	0	transcript_id "g55.t2"; gene_id "g55";
NW_003724208.1	AUGUSTUS	tts	324623	324623	.	+	.	transcript_id "g55.t2"; gene_id "g55";
# coding sequence = [atgcaagcacatcattctaaacccttgtacaataccaacttgttcatgcagcttgcaaatatcatgggtcgttttcagt
# ggctaacatgtccaaggaaggatttatcaactggttggcttcattgtgatcctggtccgttgtttaagccagagtatttcgatttatcaggatgggtt
# cctagatggtttccttggaaggaggtctccattttaccagttcagtggcatgctttatgtgtcggtttgtttgcatcaataatagcaccttttggagg
# attttttgcaagtggctttaaaagagcttttaagatcaaggactttggcgatagtattcctggacacggtggaattactgatagaatggattgtcagg
# agtttgaaccctacttttggaatggcatacaacgaggaagttactga]
# protein sequence = [MQAHHSKPLYNTNLFMQLANIMGRFQWLTCPRKDLSTGWLHCDPGPLFKPEYFDLSGWVPRWFPWKEVSILPVQWHAL
# CVGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQEFEPYFWNGIQRGSY]
NW_003724208.1	AUGUSTUS	transcript	322958	324623	0.03	+	.	g55.t3
NW_003724208.1	AUGUSTUS	tss	322958	322958	.	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	322958	323144	.	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	start_codon	323046	323048	.	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	initial	323046	323144	0.83	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	323233	323319	0.8	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	internal	324073	324201	0.64	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	terminal	324309	324452	0.12	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323145	323232	0.99	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	323320	324072	0.65	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	intron	324202	324308	0.68	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323046	323144	0.83	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	323233	323319	0.8	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	323233	323319	.	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324073	324201	0.64	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324073	324201	.	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	CDS	324309	324452	0.12	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	exon	324309	324623	.	+	.	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	stop_codon	324450	324452	.	+	0	transcript_id "g55.t3"; gene_id "g55";
NW_003724208.1	AUGUSTUS	tts	324623	324623	.	+	.	transcript_id "g55.t3"; gene_id "g55";
# coding sequence = [atgcaagcacatcattctaaacccttgtacaataccaacttgttcatgcagcttgcaaatatcatgggtcgttttcagt
# ggctaacatgtccaaggaaggatttatcaactggttggcttcattgtgatcctggtccgttgtttaagccagagtatttcgatttatcaggatgggtt
# cctagatggtttccttggaaggaggtctccattttaccagttcagtggcatgctttatgtgtcggtttgtttgcatcaataatagcaccttttggagg
# attttttgcaagtggctttaaaagagcttttaagatcaaggactttggcgatagtattcctggacacggtggaattactgatagaatggattgtcagg
# taagcttcaaagtgtgtagtgttcatctaggtgtacttgcattaggatataaacacacattgttgacagtgtttttccaagaataa]
# protein sequence = [MQAHHSKPLYNTNLFMQLANIMGRFQWLTCPRKDLSTGWLHCDPGPLFKPEYFDLSGWVPRWFPWKEVSILPVQWHAL
# CVGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQVSFKVCSVHLGVLALGYKHTLLTVFFQE]
# end gene g55
###
# command line:
# augustus --species=arabidopsis --UTR=on --strand=both --sample=100 --keep_viterbi=true --alternatives-from-sampling=true --minexonintronprob=0.08 --minmeanexonintronprob=0.4 --maxtracks=3 --genemodel=partial /data/www/augpred/webdata/predRhPG7WvS/genome.fa --codingseq=on --exonnames=on