In [ ]:
! cd /tmp/ ; wget https://salilab.org/modeller/10.1/modeller_10.1-1_amd64.deb
! env KEY_MODELLER="MODELIRANJE" dpkg -i /tmp/modeller_10.1-1_amd64.deb
--2026-05-01 16:05:27--  https://salilab.org/modeller/10.1/modeller_10.1-1_amd64.deb
Resolving salilab.org (salilab.org)... 169.230.79.19
Connecting to salilab.org (salilab.org)|169.230.79.19|:443... connected.
HTTP request sent, awaiting response... 200 OK
Length: 14404568 (14M) [application/vnd.debian.binary-package]
Saving to: ‘modeller_10.1-1_amd64.deb.5’

modeller_10.1-1_amd 100%[===================>]  13.74M  9.11MB/s    in 1.5s    

2026-05-01 16:05:29 (9.11 MB/s) - ‘modeller_10.1-1_amd64.deb.5’ saved [14404568/14404568]

(Reading database ... 120308 files and directories currently installed.)
Preparing to unpack /tmp/modeller_10.1-1_amd64.deb ...
Unpacking modeller (10.1-1) over (10.1-1) ...
Setting up modeller (10.1-1) ...
In [ ]:
! echo -e "install_dir = r'/usr/lib/modeller10.1'\nlicense = 'MODELIRANJE'" > /usr/lib/modeller10.1/modlib/modeller/config.py
In [ ]:
! wget 	https://files.rcsb.org/download/1b8p.pdb
! wget 	https://files.rcsb.org/download/1bdm.pdb
--2026-05-01 16:05:32--  https://files.rcsb.org/download/1b8p.pdb
Resolving files.rcsb.org (files.rcsb.org)... 3.175.207.56, 3.175.207.75, 3.175.207.24, ...
Connecting to files.rcsb.org (files.rcsb.org)|3.175.207.56|:443... connected.
HTTP request sent, awaiting response... 200 OK
Length: unspecified [text/plain]
Saving to: ‘1b8p.pdb.4’

1b8p.pdb.4              [  <=>               ] 237.94K   463KB/s    in 0.5s    

2026-05-01 16:05:33 (463 KB/s) - ‘1b8p.pdb.4’ saved [243648]

--2026-05-01 16:05:33--  https://files.rcsb.org/download/1bdm.pdb
Resolving files.rcsb.org (files.rcsb.org)... 3.175.207.56, 3.175.207.75, 3.175.207.24, ...
Connecting to files.rcsb.org (files.rcsb.org)|3.175.207.56|:443... connected.
HTTP request sent, awaiting response... 200 OK
Length: unspecified [text/plain]
Saving to: ‘1bdm.pdb.4’

1bdm.pdb.4              [   <=>              ] 467.33K   686KB/s    in 0.7s    

2026-05-01 16:05:34 (686 KB/s) - ‘1bdm.pdb.4’ saved [478548]

In [ ]:
# Гомологичное моделирование комплекса белка с лигандом
# Будем работать с белком LYS_BPPHV, будем строить комплекс этого лизоцима с лигандом с помощью программы Modeller
#Загрузим модуль
In [ ]:
import sys
sys.path.append('/usr/lib/python3.9/dist-packages')
In [ ]:
from  modeller import *
In [ ]:
  import sys
  import modeller
  import _modeller
  import modeller.automodel
In [ ]:
env=modeller.Environ()
env.io.hetatm = True
In [ ]:
# Скачаем белок заготовку лизоцима форели
In [ ]:
! wget 	https://files.rcsb.org/download/1lmp.pdb
--2026-05-01 14:01:51--  https://files.rcsb.org/download/1lmp.pdb
Resolving files.rcsb.org (files.rcsb.org)... 3.175.207.24, 3.175.207.56, 3.175.207.54, ...
Connecting to files.rcsb.org (files.rcsb.org)|3.175.207.24|:443... connected.
HTTP request sent, awaiting response... 200 OK
Length: unspecified [text/plain]
Saving to: ‘1lmp.pdb.1’

1lmp.pdb.1              [   <=>              ] 126.40K   217KB/s    in 0.6s    

2026-05-01 14:01:52 (217 KB/s) - ‘1lmp.pdb.1’ saved [129438]

In [ ]:
# Скачаем последовательность LYS_BPPHV
In [ ]:
! wget http://www.uniprot.org/uniprot/P62693.fasta
--2026-05-01 14:01:52--  http://www.uniprot.org/uniprot/P62693.fasta
Resolving www.uniprot.org (www.uniprot.org)... 193.62.193.81
Connecting to www.uniprot.org (www.uniprot.org)|193.62.193.81|:80... connected.
HTTP request sent, awaiting response... 301 Moved Permanently
Location: https://www.uniprot.org/uniprot/P62693.fasta [following]
--2026-05-01 14:01:53--  https://www.uniprot.org/uniprot/P62693.fasta
Connecting to www.uniprot.org (www.uniprot.org)|193.62.193.81|:443... connected.
HTTP request sent, awaiting response... 301 Moved Permanently
Location: https://rest.uniprot.org/uniprot/P62693.fasta [following]
--2026-05-01 14:01:54--  https://rest.uniprot.org/uniprot/P62693.fasta
Resolving rest.uniprot.org (rest.uniprot.org)... 193.62.192.81
Connecting to rest.uniprot.org (rest.uniprot.org)|193.62.192.81|:443... connected.
HTTP request sent, awaiting response... 301 Moved Permanently
Location: https://rest.uniprot.org/uniprotkb/P62693.fasta [following]
--2026-05-01 14:01:55--  https://rest.uniprot.org/uniprotkb/P62693.fasta
Reusing existing connection to rest.uniprot.org:443.
HTTP request sent, awaiting response... 200 OK
Length: 317 [text/plain]
Saving to: ‘P62693.fasta.1’

P62693.fasta.1      100%[===================>]     317  --.-KB/s    in 0s      

2026-05-01 14:01:55 (117 MB/s) - ‘P62693.fasta.1’ saved [317/317]

In [ ]:
# Создадим объект выравнивание
In [ ]:
alignm=modeller.Alignment(env)
In [ ]:
# Добавим последовательность и структуру
In [ ]:
alignm.append(file='P62693.fasta', align_codes='all',alignment_format='FASTA')
## создадим модель
mdl = modeller.Model(env, file='1lmp.pdb', model_segment=('FIRST:'+'A', 'LAST:'+'A'))
## и добавим в выравнивание
alignm.append_model(mdl, atom_files='1lmp.pdb', align_codes='1lmp')
## есть смысл поправить идентификаторы
alignm[0].code = 'P62693'
In [ ]:
# Делаем выравнивание и сохраняем
In [ ]:
alignm.salign()
alignm.write(file='all_in_one.ali', alignment_format='PIR')
SALIGN_____> adding the next group to the alignment; iteration    1
In [ ]:
! cat all_in_one.ali
>P1;P62693
sequence::: :: :::-1.00:-1.00
MKVSQNGLNLIKEFEGCRLTAYKPVPWEQMYTIGWGHYGVTAGTTWTQAQADSQLEIDINNKYAPMVDAYVKGKA
NQNEFDALVSLAYNCGNVFVADGWAPFSHAYCASMIPKYRNAGGQVLQGLVRRRQAELNLFNKPVSSNSNQNNQT
GGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKLNLPVDTMFIAEIEAEFGRKIDMASGEV
K*

>P1;1lmp
structureX:1lmp.pdb:1:A:+129:A:MOL_ID  1; MOLECULE  LYSOZYME; CHAIN  A; SYNONYM  MUCOPEPTIDE N-ACETYLMURAMYLHYDROLASE; EC  3.2.1.17:MOL_ID  1; ORGANISM_SCIENTIFIC  ONCORHYNCHUS MYKISS; ORGANISM_COMMON  RAINBOW TROUT; ORGANISM_TAXID  8022; ORGAN  KIDNEY: 2.00: 0.16
KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGI-FQINSRY------------
------------------WCDDGRTPGAKNVCGIRCSQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQD
------------------------------------------------------------------LRSYVAGCG
V*
In [ ]:
# Построим модель
In [ ]:
## Выбираем объект для моделирования
s = alignm[0]
pdb = alignm[1]

print(s.code, pdb.code)

## Создаем объект automodel
a = modeller.automodel.automodel(env, alnfile='all_in_one.ali', knowns= pdb.code , sequence = s.code )

a.name='mod'+s.code
a.starting_model = 1
a.ending_model = 2
a.make()
P62693 1lmp
automodel__W> The class 'automodel' is deprecated; use 'AutoModel' instead
AutoModel__W> Topology and/or parameter libraries already in memory. These will
                be used instead of the AutoModel defaults. If this is not what you
                want, clear them before creating the AutoModel object with
                env.libs.topology.clear() and env.libs.parameters.clear()

check_ali___> Checking the sequence-structure alignment. 

Implied intrachain target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
0 atoms in HETATM/BLK residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
0 atoms in residues without defined topology
constrained to be rigid bodies
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    14714    13125
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      226
Number of all, selected real atoms                :     1784    1784
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    13125   13125
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     3604
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        1741.9506





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1824       0      0   0.004   0.004      9.9609       1.000
 2 Bond angle potential               :    2468       0      9   1.992   1.992      187.11       1.000
 3 Stereochemical cosine torsion poten:    1168       0     49  49.274  49.274      449.72       1.000
 4 Stereochemical improper torsion pot:     773       0      0   1.196   1.196      25.568       1.000
 5 Soft-sphere overlap restraints     :    3604       0      0   0.004   0.004      7.9446       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2408       1     13   0.582   0.582      194.19       1.000
10 Distance restraints 2 (N-O)        :    2569       3     24   0.727   0.727      320.31       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     225       3      8   5.291   5.291      74.294       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      5  84.495  84.495      60.056       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      1  80.787  80.787      68.340       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      0  98.044  98.044      46.042       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0  91.994  91.994      16.820       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     915       0      0   0.541   0.541      13.636       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     224     101     41  37.473 115.773      255.70       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     131       0      1   1.198   1.198      12.265       1.000
27 Distance restraints 5 (X-Y)        :       0       0      0   0.000   0.000      0.0000       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   36955.2812



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature  9                           : Distance restraints 1 (CA-CA)           
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   8924  94F 129R CA  CA    731 1003   10.19    7.73    2.46    4.66    7.73    2.46    4.66

-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  10890  94F 138K N   O     730 1087   15.76   10.64    5.12    4.92   10.64    5.12    4.92

-------------------------------------------------------------------------------------------------

Feature 13                           : Mainchain Omega dihedral restraints     
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6520  63Y  63Y CA  C     496  505 -157.16 -180.00   22.84    4.57 -180.00   22.84    4.57
    2   6681 224E 224E CA  C    1760 1766 -155.66 -180.00   24.34    4.87 -180.00   24.34    4.87

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6251  18R  19L C   N     141  143   65.22   60.20    5.67    0.45  -63.50  145.66   26.86
    1         19L  19L N   CA    143  144   26.97   29.60                  -41.20
    2   6253  20T  21A C   N     156  158   55.09   55.40    4.55    0.30  -62.50  139.23   28.29
    2         21A  21A N   CA    158  159   33.66   38.20                  -40.90
    3   6254  21A  22Y C   N     161  163   64.98   55.90   10.92    0.81  -63.50  149.70   28.28
    3         22Y  22Y N   CA    163  164   33.43   39.50                  -43.40
    4   6265  32T  33I C   N     262  264  -83.84 -120.60   63.29    4.86  -63.40  136.12   23.05
    4         33I  33I N   CA    264  265 -178.18  130.30                  -43.60
    5   6266  33I  34G C   N     270  272   78.20   78.70   75.49    2.13  -62.40  149.03   24.19
    5         34G  34G N   CA    272  273  -90.61 -166.10                  -41.20
    6   6270  37H  38Y C   N     302  304   62.53   55.90   13.03    0.63  -63.50  144.99   27.36
    6         38Y  38Y N   CA    304  305   28.28   39.50                  -43.40
    7   6279  46W  47T C   N     369  371  -76.78 -124.80   54.83    2.12  -63.20  159.71   19.61
    7         47T  47T N   CA    371  372  117.03  143.50                  -42.10
    8   6280  47T  48Q C   N     376  378   90.02 -121.10  150.88    6.20  -63.80 -141.26   39.35
    8         48Q  48Q N   CA    378  379  115.21  139.70                  -40.30
    9   6281  48Q  49A C   N     385  387  -49.92  -68.20   50.74    3.47  -62.50  139.43   23.49
    9         49A  49A N   CA    387  388   97.96  145.30                  -40.90
   10   6295  62K  63Y C   N     493  495    7.14  -98.40  108.53    5.14  -63.50  162.67   29.28
   10         63Y  63Y N   CA    495  496  103.13  128.40                  -43.40
   11   6298  65P  66M C   N     517  519 -150.04 -125.60   31.60    0.94  -63.40 -178.95   33.77
   11         66M  66M N   CA    519  520  160.53  140.50                  -40.50
   12   6300  67V  68D C   N     532  534 -104.24  -96.50    8.30    0.34  -63.30  156.68   17.28
   12         68D  68D N   CA    534  535  111.23  114.20                  -40.00
   13   6301  68D  69A C   N     540  542 -125.76 -134.00   15.34    0.59  -62.50 -173.96   28.16
   13         69A  69A N   CA    542  543  134.06  147.00                  -40.90
   14   6302  69A  70Y C   N     545  547 -126.32 -124.30    7.96    0.51  -63.50 -177.73   26.07
   14         70Y  70Y N   CA    547  548  127.70  135.40                  -43.40
   15   6304  71V  72K C   N     564  566 -153.31 -118.00   39.76    1.32  -62.90 -174.64   29.47
   15         72K  72K N   CA    566  567  157.39  139.10                  -40.80
   16   6305  72K  73G C   N     573  575 -164.13 -167.20   25.94    0.98   82.20 -179.40   13.52
   16         73G  73G N   CA    575  576  148.84  174.60                    8.50
   17   6306  73G  74K C   N     577  579 -126.84 -118.00   11.23    0.38  -62.90 -175.39   27.79
   17         74K  74K N   CA    579  580  146.02  139.10                  -40.80
   18   6307  74K  75A C   N     586  588 -124.49 -134.00    9.91    0.24  -62.50 -174.46   33.72
   18         75A  75A N   CA    588  589  144.22  147.00                  -40.90
   19   6308  75A  76N C   N     591  593 -115.80 -119.90    4.57    0.23  -63.20 -172.58   26.43
   19         76N  76N N   CA    593  594  139.02  137.00                  -41.10
   20   6309  76N  77Q C   N     599  601  -79.24  -73.00    6.30    0.43  -63.80  178.85   27.12
   20         77Q  77Q N   CA    601  602  141.52  140.70                  -40.30
   21   6310  77Q  78N C   N     608  610 -134.41 -119.90   31.22    1.05  -63.20  169.91   25.26
   21         78N  78N N   CA    610  611  164.64  137.00                  -41.10
   22   6312  79E  80F C   N     625  627 -139.87 -124.20   36.58    2.00  -63.20  172.53   19.81
   22         80F  80F N   CA    627  628  110.25  143.30                  -44.30
   23   6313  80F  81D C   N     636  638 -159.59  -96.50   67.45    2.78  -63.30 -157.58   21.47
   23         81D  81D N   CA    638  639  138.05  114.20                  -40.00
   24   6314  81D  82A C   N     644  646  -98.42  -68.20   37.94    3.74  -62.50  167.18   25.88
   24         82A  82A N   CA    646  647  122.38  145.30                  -40.90
   25   6315  82A  83L C   N     649  651 -117.34 -108.50   11.14    0.49  -63.50 -172.58   29.34
   25         83L  83L N   CA    651  652  139.28  132.50                  -41.20
   26   6317  84V  85S C   N     664  666  -75.37  -72.40    3.31    0.26  -64.10  174.42   13.34
   26         85S  85S N   CA    666  667  150.95  152.40                  -35.00
   27   6318  85S  86L C   N     670  672  -75.72  -70.70    5.72    0.41  -63.50  174.88   25.00
   27         86L  86L N   CA    672  673  144.34  141.60                  -41.20
   28   6319  86L  87A C   N     678  680 -128.66 -134.00   10.81    0.67  -62.50  175.64   32.33
   28         87A  87A N   CA    680  681  156.40  147.00                  -40.90
   29   6320  87A  88Y C   N     683  685  -79.51  -98.40   19.12    0.76  -63.50  175.50   27.04
   29         88Y  88Y N   CA    685  686  131.37  128.40                  -43.40
   30   6321  88Y  89N C   N     695  697 -100.02 -119.90   20.09    0.76  -63.20  179.07   20.57
   30         89N  89N N   CA    697  698  134.15  137.00                  -41.10
   31   6322  89N  90C C   N     703  705   58.02  -69.10  133.42   12.34 -117.90 -179.32    6.88
   31         90C  90C N   CA    705  706 -177.67  141.80                  141.10
   32   6323  90C  91G C   N     709  711 -128.84 -167.20   42.65    0.65   82.20 -150.40   16.09
   32         91G  91G N   CA    711  712  155.96  174.60                    8.50
   33   6324  91G  92N C   N     713  715  -73.44  -71.20    2.53    0.20  -63.20  177.58   22.77
   33         92N  92N N   CA    715  716  141.62  142.80                  -41.10
   34   6326  93V  94F C   N     728  730  158.63 -124.20   99.01    2.57  -63.20  176.84   31.88
   34         94F  94F N   CA    730  731 -154.66  143.30                  -44.30
   35   6331  98G  99W C   N     763  765 -126.83 -124.90   87.98    4.32  -63.00  118.33   13.15
   35         99W  99W N   CA    765  766   55.44  143.40                  -44.20
   36   6333 100A 101P C   N     782  784  -45.05  -58.70   49.79    3.16  -64.50  135.82   11.19
   36        101P 101P N   CA    784  785  -78.38  -30.50                  147.20
   37   6334 101P 102F C   N     789  791 -113.30 -124.20   50.85    2.10   58.10 -178.16   20.35
   37        102F 102F N   CA    791  792   93.64  143.30                   32.90
   38   6336 103S 104H C   N     806  808 -155.98 -125.60   74.39    3.28  -63.20  146.37   15.94
   38        104H 104H N   CA    808  809   70.90  138.80                  -42.30
   39   6337 104H 105A C   N     816  818  -61.39  -68.20   27.21    2.42  -62.50  147.46   24.11
   39        105A 105A N   CA    818  819  171.64  145.30                  -40.90
   40   6339 106Y 107C C   N     833  835 -101.99 -117.90   66.36    2.35  -63.00  124.06   13.10
   40        107C 107C N   CA    835  836   76.67  141.10                  -41.10
   41   6340 107C 108A C   N     839  841  -30.63  -68.20   59.57    3.75  -62.50  143.55   25.20
   41        108A 108A N   CA    841  842   99.07  145.30                  -40.90
   42   6366 133L 134N C   N    1042 1044  -91.45 -119.90   62.37    2.12  -63.20  125.80   14.35
   42        134N 134N N   CA   1044 1045   81.49  137.00                  -41.10
   43   6367 134N 135L C   N    1050 1052  -59.25  -63.50   30.94    4.07 -108.50  163.25    9.21
   43        135L 135L N   CA   1052 1053  -71.85  -41.20                  132.50
   44   6379 146Q 147N C   N    1143 1145  -59.21  -63.20   10.73    1.57 -119.90  178.76    6.60
   44        147N 147N N   CA   1145 1146  -31.14  -41.10                  137.00
   45   6380 147N 148N C   N    1151 1153  -54.27  -63.20   15.81    1.70   55.90  144.60   17.42
   45        148N 148N N   CA   1153 1154  -54.15  -41.10                   39.50
   46   6384 151G 152G C   N    1179 1181  -78.80  -80.20   23.26    0.99   82.20 -125.00   17.91
   46        152G 152G N   CA   1181 1182 -162.68  174.10                    8.50
   47   6387 154I 155K C   N    1199 1201  168.58 -118.00  118.94    4.41  -62.90  154.93   26.97
   47        155K 155K N   CA   1201 1202 -127.32  139.10                  -40.80
   48   6388 155K 156M C   N    1208 1210  -59.34  -73.00   28.11    2.14  -63.40  151.98   22.38
   48        156M 156M N   CA   1210 1211  167.57  143.00                  -40.50
   49   6389 156M 157Y C   N    1216 1218 -101.83  -98.40   29.75    3.13  -63.50  147.32   21.55
   49        157Y 157Y N   CA   1218 1219   98.85  128.40                  -43.40
   50   6390 157Y 158L C   N    1228 1230 -141.30 -108.50   67.74    3.24  -63.50  148.97   25.46
   50        158L 158L N   CA   1230 1231 -168.23  132.50                  -41.20
   51   6393 160I 161G C   N    1252 1254  175.96 -167.20   17.96    0.26   82.20 -163.79   13.74
   51        161G 161G N   CA   1254 1255 -179.14  174.60                    8.50
   52   6394 161G 162L C   N    1256 1258  -85.12 -108.50   39.00    1.81  -63.50  144.12   18.88
   52        162L 162L N   CA   1258 1259  101.28  132.50                  -41.20
   53   6395 162L 163D C   N    1264 1266 -127.63  -96.50   36.63    1.52  -63.30 -174.96   19.91
   53        163D 163D N   CA   1266 1267  133.50  114.20                  -40.00
   54   6396 163D 164N C   N    1272 1274  -66.18  -71.20    8.55    0.45  -63.20  177.00   21.97
   54        164N 164N N   CA   1274 1275  135.88  142.80                  -41.10
   55   6397 164N 165S C   N    1280 1282  -72.12  -72.40    7.33    0.42  -64.10 -179.90   13.54
   55        165S 165S N   CA   1282 1283  145.07  152.40                  -35.00
   56   6398 165S 166G C   N    1286 1288   81.22   78.70   30.50    0.77   82.20  155.00    7.48
   56        166G 166G N   CA   1288 1289  163.50 -166.10                    8.50
   57   6399 166G 167K C   N    1290 1292 -124.48 -118.00    6.48    0.25  -62.90 -169.95   22.14
   57        167K 167K N   CA   1292 1293  139.00  139.10                  -40.80
   58   6400 167K 168A C   N    1299 1301 -129.90 -134.00    4.59    0.23  -62.50 -177.08   33.58
   58        168A 168A N   CA   1301 1302  149.06  147.00                  -40.90
   59   6401 168A 169K C   N    1304 1306 -100.05 -118.00   23.28    0.80  -62.90  169.21   20.24
   59        169K 169K N   CA   1306 1307  124.28  139.10                  -40.80
   60   6402 169K 170H C   N    1313 1315 -127.73 -125.60   13.95    0.57  -63.20  179.33   19.37
   60        170H 170H N   CA   1315 1316  125.02  138.80                  -42.30
   61   6403 170H 171W C   N    1323 1325 -120.72 -124.90   29.29    1.32  -63.00  168.78   18.66
   61        171W 171W N   CA   1325 1326  114.41  143.40                  -44.20
   62   6404 171W 172Y C   N    1337 1339 -130.31 -124.30   11.22    0.85  -63.50 -177.97   25.90
   62        172Y 172Y N   CA   1339 1340  125.92  135.40                  -43.40
   63   6406 173V 174S C   N    1356 1358 -116.78 -136.60   21.56    0.68  -64.10 -174.64   11.45
   63        174S 174S N   CA   1358 1359  142.71  151.20                  -35.00
   64   6407 174S 175D C   N    1362 1364  -96.31  -96.50    3.77    0.16  -63.30  154.02   17.27
   64        175D 175D N   CA   1364 1365  110.44  114.20                  -40.00
   65   6408 175D 176G C   N    1370 1372   67.64   78.70   12.12    0.45   82.20  170.26    8.99
   65        176G 176G N   CA   1372 1373 -161.14 -166.10                    8.50
   66   6410 177V 178S C   N    1381 1383 -103.03  -72.40   33.61    2.68  -64.10  177.88   11.18
   66        178S 178S N   CA   1383 1384  138.57  152.40                  -35.00
   67   6412 179V 180R C   N    1394 1396 -109.59 -125.20   24.10    0.76  -63.00  169.85   20.24
   67        180R 180R N   CA   1396 1397  122.24  140.60                  -41.10
   68   6413 180R 181H C   N    1405 1407 -139.56 -125.60   16.72    0.74  -63.20 -171.91   20.13
   68        181H 181H N   CA   1407 1408  129.60  138.80                  -42.30
   69   6415 182V 183R C   N    1422 1424 -132.71 -125.20    7.51    0.30  -63.00 -168.46   30.67
   69        183R 183R N   CA   1424 1425  140.50  140.60                  -41.10
   70   6416 183R 184T C   N    1433 1435 -132.54 -124.80   11.11    0.36  -63.20 -179.70   27.68
   70        184T 184T N   CA   1435 1436  151.47  143.50                  -42.10
   71   6418 185I 186R C   N    1448 1450 -170.69 -125.20   46.97    1.60  -63.00 -161.61   33.96
   71        186R 186R N   CA   1450 1451  152.28  140.60                  -41.10
   72   6419 186R 187M C   N    1459 1461 -143.89 -125.60   19.41    0.62  -63.40 -169.65   34.75
   72        187M 187M N   CA   1461 1462  147.00  140.50                  -40.50
   73   6420 187M 188L C   N    1467 1469 -120.49 -108.50   37.20    1.86  -63.50  161.47   25.95
   73        188L 188L N   CA   1469 1470  167.72  132.50                  -41.20
   74   6421 188L 189E C   N    1475 1477  -67.23  -69.30   41.65    3.11  -63.60  141.25   18.64
   74        189E 189E N   CA   1477 1478  100.90  142.50                  -40.30
   75   6422 189E 190N C   N    1484 1486 -144.96 -119.90   37.20    1.10  -63.20  174.71   26.43
   75        190N 190N N   CA   1486 1487  164.50  137.00                  -41.10
   76   6424 191Y 192Q C   N    1504 1506 -146.05 -121.10   50.04    1.86  -63.80  159.48   27.65
   76        192Q 192Q N   CA   1506 1507 -176.93  139.70                  -40.30
   77   6425 192Q 193N C   N    1513 1515  -68.18  -71.20   11.79    0.84  -63.20  164.78   20.88
   77        193N 193N N   CA   1515 1516  154.20  142.80                  -41.10
   78   6426 193N 194K C   N    1521 1523  -60.69  -70.20   14.62    0.88  -62.90  170.11   22.21
   78        194K 194K N   CA   1523 1524  129.30  140.40                  -40.80
   79   6427 194K 195W C   N    1530 1532 -135.60 -124.90   20.83    0.74  -63.00  170.74   26.23
   79        195W 195W N   CA   1532 1533  161.27  143.40                  -44.20
   80   6428 195W 196A C   N    1544 1546 -130.85 -134.00    5.40    0.33  -62.50 -178.89   33.34
   80        196A 196A N   CA   1546 1547  151.39  147.00                  -40.90
   81   6429 196A 197K C   N    1549 1551  -67.44  -70.20    9.93    0.65  -62.90  171.72   22.06
   81        197K 197K N   CA   1551 1552  130.86  140.40                  -40.80
   82   6430 197K 198L C   N    1558 1560 -114.52 -108.50   12.39    0.71  -63.50  170.68   21.38
   82        198L 198L N   CA   1560 1561  121.68  132.50                  -41.20
   83   6431 198L 199N C   N    1566 1568 -133.63 -119.90   14.07    0.66  -63.20 -171.35   20.60
   83        199N 199N N   CA   1568 1569  133.91  137.00                  -41.10
   84   6432 199N 200L C   N    1574 1576  -90.84 -108.50   19.68    1.05  -63.50  179.70   26.60
   84        200L 200L N   CA   1576 1577  141.19  132.50                  -41.20
   85   6435 202V 203D C   N    1596 1598  -59.33  -70.90   29.41    1.00  -63.30  163.31   20.40
   85        203D 203D N   CA   1598 1599  123.26  150.30                  -40.00
   86   6436 203D 204T C   N    1604 1606  -79.62  -78.10   28.70    1.28  -63.20  164.07   20.00
   86        204T 204T N   CA   1606 1607  121.14  149.80                  -42.10
   87   6437 204T 205M C   N    1611 1613  -77.03  -73.00    6.44    0.40  -63.40  172.01   26.76
   87        205M 205M N   CA   1613 1614  148.02  143.00                  -40.50
   88   6438 205M 206F C   N    1619 1621 -142.98 -124.20   59.24    2.27  -63.20  140.97   24.47
   88        206F 206F N   CA   1621 1622 -160.52  143.30                  -44.30
   89   6440 207I 208A C   N    1638 1640  -50.65  -68.20   17.80    1.60  -62.50  171.25   27.51
   89        208A 208A N   CA   1640 1641  148.26  145.30                  -40.90
   90   6443 210I 211E C   N    1660 1662  -73.36  -69.30    6.06    0.34  -63.60  172.98   23.60
   90        211E 211E N   CA   1662 1663  146.99  142.50                  -40.30
   91   6444 211E 212A C   N    1669 1671  -69.18  -68.20    5.83    0.50  -62.50  179.67   29.78
   91        212A 212A N   CA   1671 1672  139.55  145.30                  -40.90
   92   6445 212A 213E C   N    1674 1676 -133.11 -117.80   21.15    1.12  -63.60  176.76   20.67
   92        213E 213E N   CA   1676 1677  122.21  136.80                  -40.30
   93   6446 213E 214F C   N    1683 1685   -8.86  -71.40  102.25    9.08  -63.20  108.67   12.34
   93        214F 214F N   CA   1685 1686 -138.41  140.70                  -44.30
   94   6447 214F 215G C   N    1694 1696   93.07   78.70   57.72    1.08   82.20  129.94    6.85
   94        215G 215G N   CA   1696 1697  137.99 -166.10                    8.50
   95   6448 215G 216R C   N    1698 1700 -127.17 -125.20   24.48    1.14  -63.00  166.74   26.93
   95        216R 216R N   CA   1700 1701  165.00  140.60                  -41.10
   96   6449 216R 217K C   N    1709 1711 -158.24 -118.00   89.91    3.66  -62.90  137.95   23.37
   96        217K 217K N   CA   1711 1712 -140.49  139.10                  -40.80
   97   6450 217K 218I C   N    1718 1720 -151.43 -120.60   73.47    5.31  -63.40  138.72   21.15
   97        218I 218I N   CA   1720 1721   63.61  130.30                  -43.60
   98   6451 218I 219D C   N    1726 1728   49.28  -63.30  126.15   21.54  -63.30  126.15   21.54
   98        219D 219D N   CA   1728 1729   16.92  -40.00                  -40.00
   99   6454 221A 222S C   N    1747 1749   51.14  -72.40  141.13   11.33  -72.40  141.13   11.33
   99        222S 222S N   CA   1749 1750 -139.36  152.40                  152.40
  100   6455 222S 223G C   N    1753 1755  -70.24  -80.20   91.30    3.10   82.20  169.83    7.87
  100        223G 223G N   CA   1755 1756   83.35  174.10                    8.50
  101   6457 224E 225V C   N    1766 1768  -30.19  -62.40   33.36    4.82 -125.40 -168.98   10.96
  101        225V 225V N   CA   1768 1769  -51.10  -42.40                  143.30


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    1   24   37  136  135  207  182  197  253  254  274


<< end of ENERGY.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      226
Number of all, selected real atoms                :     1784    1784
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    13125   13125
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     3525
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        1723.5474





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1824       0      0   0.004   0.004      9.0218       1.000
 2 Bond angle potential               :    2468       1      5   1.922   1.922      169.99       1.000
 3 Stereochemical cosine torsion poten:    1168       0     58  51.177  51.177      466.84       1.000
 4 Stereochemical improper torsion pot:     773       0      1   1.151   1.151      21.874       1.000
 5 Soft-sphere overlap restraints     :    3525       0      0   0.004   0.004      6.6453       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2408       1     23   0.517   0.517      233.00       1.000
10 Distance restraints 2 (N-O)        :    2569       4     25   0.619   0.619      289.09       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     225       1      4   4.728   4.728      59.302       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      3  83.294  83.294      64.913       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      2  80.345  80.345      72.402       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      0  84.336  84.336      43.752       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0  78.560  78.560      13.888       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     915       0      0   0.507   0.507      18.632       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     224      99     39  36.577 113.967      236.81       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     131       0      0   1.318   1.318      17.397       1.000
27 Distance restraints 5 (X-Y)        :       0       0      0   0.000   0.000      0.0000       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990002
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   36250.9531



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature  2                           : Bond angle potential                    
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   2072  24P  24P N   CA    184  185  134.10  108.20   25.91    5.89  108.20   25.91    5.89

-------------------------------------------------------------------------------------------------

Feature  9                           : Distance restraints 1 (CA-CA)           
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   8924  94F 129R CA  CA    731 1003   10.33    7.73    2.60    4.93    7.73    2.60    4.93

-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  10890  94F 138K N   O     730 1087   15.76   10.64    5.11    4.91   10.64    5.11    4.91

-------------------------------------------------------------------------------------------------

Feature 13                           : Mainchain Omega dihedral restraints     
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6480  23K  23K CA  C     176  182 -147.88 -180.00   32.11    6.42 -180.00   32.11    6.42

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6251  18R  19L C   N     141  143   56.21   60.20   13.16    0.49  -63.50  145.87   26.81
    1         19L  19L N   CA    143  144   42.14   29.60                  -41.20
    2   6253  20T  21A C   N     156  158   49.62   55.40    9.98    0.41  -62.50  142.06   28.73
    2         21A  21A N   CA    158  159   46.34   38.20                  -40.90
    3   6254  21A  22Y C   N     161  163   60.12   55.90    5.52    0.67  -63.50  150.86   28.57
    3         22Y  22Y N   CA    163  164   43.06   39.50                  -43.40
    4   6256  23K  24P C   N     182  184  -35.38  -58.70   59.45    3.51  -64.50  130.90   11.35
    4         24P  24P N   CA    184  185  -85.18  -30.50                  147.20
    5   6257  24P  25V C   N     189  191   48.12  -62.40  134.25   16.65  -62.40  134.25   16.65
    5         25V  25V N   CA    191  192 -118.61  -42.40                  -42.40
    6   6270  37H  38Y C   N     302  304   60.59   55.90    7.64    0.40  -63.50  145.97   27.60
    6         38Y  38Y N   CA    304  305   33.47   39.50                  -43.40
    7   6273  40V  41T C   N     325  327 -101.31 -124.80   94.42    3.39  -63.20  101.57   11.00
    7         41T  41T N   CA    327  328   52.04  143.50                  -42.10
    8   6280  47T  48Q C   N     376  378  -71.52 -121.10   76.30    3.95  -63.80  122.25   18.38
    8         48Q  48Q N   CA    378  379 -162.30  139.70                  -40.30
    9   6289  56E  57I C   N     444  446 -160.05 -120.60   48.05    3.84  -63.40  175.49   26.67
    9         57I  57I N   CA    446  447  102.87  130.30                  -43.60
   10   6290  57I  58D C   N     452  454  -50.49  -96.50   48.54    2.00   54.50  119.87    9.95
   10         58D  58D N   CA    454  455   98.73  114.20                   40.90
   11   6294  61N  62K C   N     484  486 -106.38  -62.90   93.45   10.73  -62.90   93.45   10.73
   11         62K  62K N   CA    486  487   41.92  -40.80                  -40.80
   12   6295  62K  63Y C   N     493  495 -112.79  -98.40   15.34    0.74  -63.50  173.63   25.23
   12         63Y  63Y N   CA    495  496  123.08  128.40                  -43.40
   13   6296  63Y  64A C   N     505  507  148.29 -134.00   77.99    2.84  -62.50 -127.15   45.91
   13         64A  64A N   CA    507  508  140.33  147.00                  -40.90
   14   6298  65P  66M C   N     517  519 -166.33 -125.60   45.62    1.38  -63.40 -171.06   36.08
   14         66M  66M N   CA    519  520  161.06  140.50                  -40.50
   15   6300  67V  68D C   N     532  534 -103.46  -96.50    9.28    0.39  -63.30  165.28   18.34
   15         68D  68D N   CA    534  535  120.33  114.20                  -40.00
   16   6301  68D  69A C   N     540  542 -113.96 -134.00   21.32    0.50  -62.50 -173.37   33.32
   16         69A  69A N   CA    542  543  139.71  147.00                  -40.90
   17   6302  69A  70Y C   N     545  547 -117.83 -124.30   10.22    0.42  -63.50  179.32   25.93
   17         70Y  70Y N   CA    547  548  127.49  135.40                  -43.40
   18   6304  71V  72K C   N     564  566 -132.25 -118.00   22.45    0.82  -62.90  176.91   27.12
   18         72K  72K N   CA    566  567  156.45  139.10                  -40.80
   19   6305  72K  73G C   N     573  575 -161.85 -167.20   16.63    0.56   82.20 -170.13   14.12
   19         73G  73G N   CA    575  576  158.85  174.60                    8.50
   20   6306  73G  74K C   N     577  579 -109.80 -118.00    9.17    0.42  -62.90 -177.85   26.43
   20         74K  74K N   CA    579  580  143.19  139.10                  -40.80
   21   6307  74K  75A C   N     586  588 -114.31 -134.00   21.89    0.50  -62.50 -174.30   28.38
   21         75A  75A N   CA    588  589  137.43  147.00                  -40.90
   22   6308  75A  76N C   N     591  593 -125.45 -119.90    6.92    0.20  -63.20 -171.66   27.09
   22         76N  76N N   CA    593  594  141.14  137.00                  -41.10
   23   6309  76N  77Q C   N     599  601 -104.22 -121.10   27.82    0.96  -63.80  162.97   22.05
   23         77Q  77Q N   CA    601  602  117.58  139.70                  -40.30
   24   6310  77Q  78N C   N     608  610 -135.12 -119.90   19.03    0.55  -63.20 -174.97   27.21
   24         78N  78N N   CA    610  611  148.42  137.00                  -41.10
   25   6311  78N  79E C   N     616  618  -82.49  -69.30   81.05    6.63  -63.60  104.56   12.99
   25         79E  79E N   CA    618  619   62.53  142.50                  -40.30
   26   6312  79E  80F C   N     625  627 -163.69 -124.20   54.30    1.44  -63.20  168.40   29.46
   26         80F  80F N   CA    627  628 -179.43  143.30                  -44.30
   27   6313  80F  81D C   N     636  638  -80.35  -96.50   51.27    2.16  -63.30  106.90   12.26
   27         81D  81D N   CA    638  639   65.54  114.20                  -40.00
   28   6314  81D  82A C   N     644  646  -72.97  -68.20    8.24    0.52  -62.50  167.41   27.96
   28         82A  82A N   CA    646  647  152.02  145.30                  -40.90
   29   6315  82A  83L C   N     649  651  -70.69  -70.70    4.87    0.37  -63.50  178.08   24.32
   29         83L  83L N   CA    651  652  136.73  141.60                  -41.20
   30   6317  84V  85S C   N     664  666  -63.06  -72.40   20.23    0.94  -64.10  169.46   12.34
   30         85S  85S N   CA    666  667  134.46  152.40                  -35.00
   31   6318  85S  86L C   N     670  672  -76.37  -70.70    5.72    0.49  -63.50  176.92   25.32
   31         86L  86L N   CA    672  673  142.35  141.60                  -41.20
   32   6319  86L  87A C   N     678  680  -69.40  -68.20    1.20    0.10  -62.50  174.02   28.86
   32         87A  87A N   CA    680  681  145.22  145.30                  -40.90
   33   6320  87A  88Y C   N     683  685 -116.61 -124.30    9.62    0.48  -63.50 -179.01   26.23
   33         88Y  88Y N   CA    685  686  129.62  135.40                  -43.40
   34   6321  88Y  89N C   N     695  697 -106.81 -119.90   24.57    0.79  -63.20  163.24   18.35
   34         89N  89N N   CA    697  698  116.21  137.00                  -41.10
   35   6323  90C  91G C   N     709  711 -140.10 -167.20   47.27    1.28   82.20 -172.44   14.48
   35         91G  91G N   CA    711  712  135.86  174.60                    8.50
   36   6324  91G  92N C   N     713  715  -77.54  -71.20   10.05    0.53  -63.20  168.91   21.92
   36         92N  92N N   CA    715  716  150.60  142.80                  -41.10
   37   6326  93V  94F C   N     728  730  158.14 -124.20   96.43    2.50  -63.20 -179.70   32.47
   37         94F  94F N   CA    730  731 -159.54  143.30                  -44.30
   38   6331  98G  99W C   N     763  765 -127.46 -124.90  101.31    4.98  -63.00  107.73   12.18
   38         99W  99W N   CA    765  766   42.13  143.40                  -44.20
   39   6336 103S 104H C   N     806  808 -159.56 -125.60   90.07    3.94  -63.20  137.21   15.39
   39        104H 104H N   CA    808  809   55.38  138.80                  -42.30
   40   6337 104H 105A C   N     816  818  -68.95  -68.20   18.76    1.49  -62.50  155.19   25.75
   40        105A 105A N   CA    818  819  164.04  145.30                  -40.90
   41   6340 107C 108A C   N     839  841   61.77   55.40   12.13    1.23  -62.50  153.10   31.04
   41        108A 108A N   CA    841  842   48.52   38.20                  -40.90
   42   6349 116N 117A C   N     913  915  -63.76  -68.20    9.60    0.91  -62.50  165.30   27.15
   42        117A 117A N   CA    915  916  153.81  145.30                  -40.90
   43   6350 117A 118G C   N     918  920  110.71   78.70   43.72    2.36  -80.20  176.21    9.88
   43        118G 118G N   CA    920  921 -136.32 -166.10                  174.10
   44   6351 118G 119G C   N     922  924  142.64   82.20   61.17    3.72  -62.40  160.10   26.69
   44        119G 119G N   CA    924  925   -0.94    8.50                  -41.20
   45   6366 133L 134N C   N    1042 1044  -85.70  -71.20   59.92    4.24  -63.20  127.75   14.84
   45        134N 134N N   CA   1044 1045   84.66  142.80                  -41.10
   46   6367 134N 135L C   N    1050 1052  -55.49  -63.50   70.08    9.30 -108.50  128.16    7.29
   46        135L 135L N   CA   1052 1053 -110.82  -41.20                  132.50
   47   6383 150T 151G C   N    1175 1177  140.69 -167.20   52.18    0.93   82.20  178.65   11.44
   47        151G 151G N   CA   1177 1178  177.31  174.60                    8.50
   48   6384 151G 152G C   N    1179 1181 -118.87  -80.20   56.19    3.93   82.20 -157.91   15.74
   48        152G 152G N   CA   1181 1182  133.33  174.10                    8.50
   49   6385 152G 153M C   N    1183 1185 -153.66 -125.60   40.35    1.24  -63.40  175.06   33.09
   49        153M 153M N   CA   1185 1186  169.50  140.50                  -40.50
   50   6387 154I 155K C   N    1199 1201 -130.41 -118.00   47.80    2.12  -62.90  149.98   23.52
   50        155K 155K N   CA   1201 1202 -174.73  139.10                  -40.80
   51   6388 155K 156M C   N    1208 1210  -60.75  -73.00   22.11    1.71  -63.40  158.11   23.40
   51        156M 156M N   CA   1210 1211  161.41  143.00                  -40.50
   52   6389 156M 157Y C   N    1216 1218  -65.26  -98.40   35.68    2.01  -63.50  158.59   25.07
   52        157Y 157Y N   CA   1218 1219  115.18  128.40                  -43.40
   53   6390 157Y 158L C   N    1228 1230 -166.31 -108.50   58.18    2.70  -63.50 -152.92   35.08
   53        158L 158L N   CA   1230 1231  139.05  132.50                  -41.20
   54   6394 161G 162L C   N    1256 1258  -62.53  -70.70   13.58    0.84  -63.50  171.96   23.93
   54        162L 162L N   CA   1258 1259  130.75  141.60                  -41.20
   55   6395 162L 163D C   N    1264 1266 -113.82  -96.50   17.34    0.71  -63.30  163.14   17.72
   55        163D 163D N   CA   1266 1267  115.12  114.20                  -40.00
   56   6396 163D 164N C   N    1272 1274 -117.50 -119.90   12.46    0.51  -63.20  174.53   19.36
   56        164N 164N N   CA   1274 1275  124.77  137.00                  -41.10
   57   6397 164N 165S C   N    1280 1282 -133.97 -136.60    2.66    0.10  -64.10 -172.29   18.55
   57        165S 165S N   CA   1282 1283  150.78  151.20                  -35.00
   58   6398 165S 166G C   N    1286 1288  177.29 -167.20   30.92    1.25   82.20  168.70   12.31
   58        166G 166G N   CA   1288 1289  147.85  174.60                    8.50
   59   6399 166G 167K C   N    1290 1292 -117.72 -118.00   23.46    1.14  -62.90  165.77   19.29
   59        167K 167K N   CA   1292 1293  115.64  139.10                  -40.80
   60   6400 167K 168A C   N    1299 1301 -156.59 -134.00   22.61    0.78  -62.50 -163.05   37.31
   60        168A 168A N   CA   1301 1302  146.08  147.00                  -40.90
   61   6401 168A 169K C   N    1304 1306 -133.57 -118.00   19.04    0.92  -62.90 -176.86   21.13
   61        169K 169K N   CA   1306 1307  128.15  139.10                  -40.80
   62   6402 169K 170H C   N    1313 1315 -127.44 -125.60    2.01    0.08  -63.20 -169.16   28.07
   62        170H 170H N   CA   1315 1316  137.99  138.80                  -42.30
   63   6403 170H 171W C   N    1323 1325 -120.88 -124.90    4.34    0.23  -63.00 -179.70   26.40
   63        171W 171W N   CA   1325 1326  145.05  143.40                  -44.20
   64   6404 171W 172Y C   N    1337 1339 -113.37  -98.40   15.51    0.68  -63.50  175.01   25.43
   64        172Y 172Y N   CA   1339 1340  124.35  128.40                  -43.40
   65   6406 173V 174S C   N    1356 1358 -100.52  -72.40   31.48    2.52  -64.10  177.05   11.19
   65        174S 174S N   CA   1358 1359  138.26  152.40                  -35.00
   66   6407 174S 175D C   N    1362 1364 -100.07  -96.50   18.77    0.78  -63.30  140.67   15.51
   66        175D 175D N   CA   1364 1365   95.78  114.20                  -40.00
   67   6408 175D 176G C   N    1370 1372   70.87   78.70    9.22    0.51   82.20  179.83    9.30
   67        176G 176G N   CA   1372 1373 -170.97 -166.10                    8.50
   68   6410 177V 178S C   N    1381 1383 -115.50 -136.60   22.94    0.72  -64.10 -175.49   11.41
   68        178S 178S N   CA   1383 1384  142.21  151.20                  -35.00
   69   6412 179V 180R C   N    1394 1396  -95.91  -72.10   30.24    2.62  -63.00  167.62   20.62
   69        180R 180R N   CA   1396 1397  123.26  141.90                  -41.10
   70   6413 180R 181H C   N    1405 1407 -113.98 -125.60   20.98    0.56  -63.20  171.34   18.83
   70        181H 181H N   CA   1407 1408  121.34  138.80                  -42.30
   71   6415 182V 183R C   N    1422 1424 -132.03 -125.20   11.31    0.63  -63.00 -174.03   21.47
   71        183R 183R N   CA   1424 1425  131.59  140.60                  -41.10
   72   6416 183R 184T C   N    1433 1435 -131.54 -124.80    6.74    0.36  -63.20 -172.43   28.56
   72        184T 184T N   CA   1435 1436  143.23  143.50                  -42.10
   73   6418 185I 186R C   N    1448 1450 -164.03 -125.20   48.89    1.44  -63.00  179.68   30.95
   73        186R 186R N   CA   1450 1451  170.31  140.60                  -41.10
   74   6419 186R 187M C   N    1459 1461  -83.77  -73.00   59.75    4.23  -63.40  126.38   17.38
   74        187M 187M N   CA   1461 1462   84.23  143.00                  -40.50
   75   6420 187M 188L C   N    1467 1469 -140.18 -108.50   38.58    1.71  -63.50 -178.70   29.92
   75        188L 188L N   CA   1469 1470  154.51  132.50                  -41.20
   76   6421 188L 189E C   N    1475 1477  -88.80  -69.30   27.09    2.49  -63.60  165.92   20.84
   76        189E 189E N   CA   1477 1478  123.70  142.50                  -40.30
   77   6422 189E 190N C   N    1484 1486 -127.39 -119.90   34.62    1.39  -63.20  161.42   23.82
   77        190N 190N N   CA   1486 1487  170.80  137.00                  -41.10
   78   6423 190N 191Y C   N    1492 1494 -123.32 -124.30   22.48    1.23  -63.50  169.63   29.92
   78        191Y 191Y N   CA   1494 1495  157.86  135.40                  -43.40
   79   6424 191Y 192Q C   N    1504 1506  -59.49  -73.00   13.53    0.95  -63.80  179.78   26.21
   79        192Q 192Q N   CA   1506 1507  139.97  140.70                  -40.30
   80   6425 192Q 193N C   N    1513 1515  -68.00  -71.20    7.26    0.55  -63.20  169.66   21.48
   80        193N 193N N   CA   1515 1516  149.31  142.80                  -41.10
   81   6426 193N 194K C   N    1521 1523  103.04   56.60  109.28   11.38  -62.90 -116.41   41.17
   81        194K 194K N   CA   1523 1524  137.53   38.60                  -40.80
   82   6427 194K 195W C   N    1530 1532 -106.52 -124.90   23.16    0.74  -63.00  178.87   20.24
   82        195W 195W N   CA   1532 1533  129.30  143.40                  -44.20
   83   6428 195W 196A C   N    1544 1546  -62.80  -68.20   15.57    1.07  -62.50  171.60   28.11
   83        196A 196A N   CA   1546 1547  130.70  145.30                  -40.90
   84   6429 196A 197K C   N    1549 1551 -160.13 -118.00   47.09    1.56  -62.90 -173.58   29.99
   84        197K 197K N   CA   1551 1552  160.14  139.10                  -40.80
   85   6430 197K 198L C   N    1558 1560  -88.75 -108.50   34.62    1.62  -63.50  147.44   19.17
   85        198L 198L N   CA   1560 1561  104.06  132.50                  -41.20
   86   6431 198L 199N C   N    1566 1568 -110.88 -119.90   47.29    1.93  -63.20  140.04   15.41
   86        199N 199N N   CA   1568 1569   90.58  137.00                  -41.10
   87   6432 199N 200L C   N    1574 1576 -139.84 -108.50   31.69    1.46  -63.50 -165.91   23.90
   87        200L 200L N   CA   1576 1577  137.25  132.50                  -41.20
   88   6435 202V 203D C   N    1596 1598 -103.54  -96.50   18.78    0.78  -63.30  142.59   15.62
   88        203D 203D N   CA   1598 1599   96.79  114.20                  -40.00
   89   6436 203D 204T C   N    1604 1606  -88.94  -78.10   40.50    1.42  -63.20  131.62   18.60
   89        204T 204T N   CA   1606 1607 -171.18  149.80                  -42.10
   90   6437 204T 205M C   N    1611 1613  -62.03  -73.00   18.37    1.15  -63.40  168.77   25.30
   90        205M 205M N   CA   1613 1614  128.26  143.00                  -40.50
   91   6438 205M 206F C   N    1619 1621 -105.38 -124.20   33.88    1.04  -63.20  164.92   20.27
   91        206F 206F N   CA   1621 1622  115.13  143.30                  -44.30
   92   6441 208A 209E C   N    1643 1645 -148.53 -117.80   31.31    1.01  -63.60 -163.78   30.91
   92        209E 209E N   CA   1645 1646  142.82  136.80                  -40.30
   93   6443 210I 211E C   N    1660 1662 -129.27 -117.80   31.17    1.70  -63.60  162.02   18.91
   93        211E 211E N   CA   1662 1663  107.81  136.80                  -40.30
   94   6444 211E 212A C   N    1669 1671   70.64  -68.20  139.27   12.17  -62.50 -149.67   31.94
   94        212A 212A N   CA   1671 1672  156.28  145.30                  -40.90
   95   6445 212A 213E C   N    1674 1676  -97.85 -117.80   23.54    1.17  -63.60  173.80   25.11
   95        213E 213E N   CA   1676 1677  149.30  136.80                  -40.30
   96   6446 213E 214F C   N    1683 1685   65.59  -71.40  139.60   10.31  -63.20 -163.72   22.33
   96        214F 214F N   CA   1685 1686  167.58  140.70                  -44.30
   97   6447 214F 215G C   N    1694 1696 -127.73 -167.20   52.24    1.89   82.20 -140.86    6.63
   97        215G 215G N   CA   1696 1697 -151.18  174.60                    8.50
   98   6448 215G 216R C   N    1698 1700 -122.49 -125.20   94.58    4.63  -63.00  102.74   17.79
   98        216R 216R N   CA   1700 1701 -124.87  140.60                  -41.10
   99   6449 216R 217K C   N    1709 1711  -74.08  -62.90   62.54    7.58  -62.90   62.54    7.58
   99        217K 217K N   CA   1711 1712   20.73  -40.80                  -40.80


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0   15   26  149  123  204  165  197  202  245  259


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
P62693.B99990001.pdb          1741.95056
P62693.B99990002.pdb          1723.54736

In [ ]:
# Посмотрим результат
In [ ]:
!pip install py3Dmol

import py3Dmol
with open("P62693.B99990001.pdb", "r") as f:
    pdb_data = f.read()

view = py3Dmol.view(width=400, height=300)
view.addModel(pdb_data, 'pdb')
view.setStyle({'cartoon': {'color': 'spectrum'}})
view.zoomTo()
view.show()
Requirement already satisfied: py3Dmol in /usr/local/lib/python3.12/dist-packages (2.5.4)

3Dmol.js failed to load for some reason. Please check your browser console for error messages.

In [ ]:
# Лизоцим без лиганда выглядит растрёпанным
In [ ]:
# Надо добавить лиганд к последовательности
In [ ]:
!cat all_in_one.ali
>P1;P62693
sequence::: :: :::-1.00:-1.00
MKVSQNGLNLIKEFEGCRLTAYKPVPWEQMYTIGWGHYGVTAGTTWTQAQADSQLEIDINNKYAPMVDAYVKGKA
NQNEFDALVSLAYNCGNVFVADGWAPFSHAYCASMIPKYRNAGGQVLQGLVRRRQAELNLFNKPVSSNSNQNNQT
GGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKLNLPVDTMFIAEIEAEFGRKIDMASGEV
K*

>P1;1lmp
structureX:1lmp.pdb:1:A:+129:A:MOL_ID  1; MOLECULE  LYSOZYME; CHAIN  A; SYNONYM  MUCOPEPTIDE N-ACETYLMURAMYLHYDROLASE; EC  3.2.1.17:MOL_ID  1; ORGANISM_SCIENTIFIC  ONCORHYNCHUS MYKISS; ORGANISM_COMMON  RAINBOW TROUT; ORGANISM_TAXID  8022; ORGAN  KIDNEY: 2.00: 0.16
KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGI-FQINSRY------------
------------------WCDDGRTPGAKNVCGIRCSQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQD
------------------------------------------------------------------LRSYVAGCG
V*
In [ ]:
%%writefile all_in_one_2.ali
>P1;P62693
sequence::: :: :::-1.00:-1.00
MKVSQNGLNLIKEFEGCRLTAYKPVP-WEQMYTIGWGHYGVTAGTTWTQAQADSQLEIDINNKYAPMVDAYVKGK
ANQNEFDALVSLAYNCGNVFVADGWAPFSHAYCASMIPKYRNAGGQVLQGLVRRRQAELNLFNKPVSSNSNQNNQ
TGGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKLNLPVDTMFIAEIEAEFGRKIDMASGE
VK/...*

>P1;1lmp
structureX:1lmp:1:A:3:B::::
KVYDRCELARALKASGMDGYAGNSLPNWVCLS--KWESSYNTQATNRNTDGSTDYGIFQIN--------------
-----------SRYWCD-----DGRTPGAKNVCG-----------------IRCSQLLTDDLT------------
---------------------------VAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV--------
--/...*
Overwriting all_in_one_2.ali
In [ ]:
#structureX:1lmp.pdb:1 :A: 132 :A:undefined:undefined:-1.00:-1.00
In [ ]:
!cat all_in_one_2.ali
>P1;P62693
sequence::: :: :::-1.00:-1.00
MKVSQNGLNLIKEFEGCRLTAYKPVP-WEQMYTIGWGHYGVTAGTTWTQAQADSQLEIDINNKYAPMVDAYVKGK
ANQNEFDALVSLAYNCGNVFVADGWAPFSHAYCASMIPKYRNAGGQVLQGLVRRRQAELNLFNKPVSSNSNQNNQ
TGGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKLNLPVDTMFIAEIEAEFGRKIDMASGE
VK/...*

>P1;1lmp
structureX:1lmp:1:A:3:B::::
KVYDRCELARALKASGMDGYAGNSLPNWVCLS--KWESSYNTQATNRNTDGSTDYGIFQIN--------------
-----------SRYWCD-----DGRTPGAKNVCG-----------------IRCSQLLTDDLT------------
---------------------------VAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV--------
--/...*
In [ ]:
#Поместим лиганд в другое место
In [ ]:
class mymodel(AutoModel):
    def special_constraints(self, aln):
         pass
    def special_restraints(self, aln):
        rsr = self.restraints
        at = self.atoms
        for x,y in [('CG:83:A','O6:229:B')]:
         rsr.add(modeller.forms.gaussian(group=modeller.physical.xy_distance,
                                            feature=modeller.features.distance(
                                            at[x],at[y]),mean=3.0, stdev=0.1))
from modeller import *
from modeller.automodel import *
a = mymodel(env, alnfile='all_in_one_2.ali', knowns='1lmp', sequence='P62693')
a.name='P62693_ligand'
a.starting_model = 1
a.ending_model = 2
a.make()
AutoModel__W> Topology and/or parameter libraries already in memory. These will
                be used instead of the AutoModel defaults. If this is not what you
                want, clear them before creating the AutoModel object with
                env.libs.topology.clear() and env.libs.parameters.clear()
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied intrachain target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
43 atoms in HETATM/BLK residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
43 atoms in residues without defined topology
constrained to be rigid bodies
distance___W> The class 'distance' is deprecated; use 'Distance' instead
gaussian___W> The class 'gaussian' is deprecated; use 'Gaussian' instead
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    16033    14444
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1827    1827
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    14444   14444
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     4150
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        2114.7380





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1824       0      2   0.008   0.008      35.810       1.000
 2 Bond angle potential               :    2468       1      8   2.236   2.236      235.64       1.000
 3 Stereochemical cosine torsion poten:    1168       0     57  50.441  50.441      471.22       1.000
 4 Stereochemical improper torsion pot:     773       1      2   1.998   1.998      58.961       1.000
 5 Soft-sphere overlap restraints     :    4150       2      2   0.008   0.008      30.779       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2356       0      5   0.598   0.598      145.04       1.000
10 Distance restraints 2 (N-O)        :    2508       2     15   0.781   0.781      256.38       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     225       1      4   5.610   5.610      83.503       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      3  85.372  85.372      81.505       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      1  77.121  77.121      85.416       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      1  85.748  85.748      49.266       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0  80.835  80.835      16.379       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     900       0      0   0.532   0.532      15.948       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     224      97     42  39.528 116.722      317.16       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     177       0      0   1.513   1.513      13.959       1.000
27 Distance restraints 5 (X-Y)        :    1401      11     24   0.139   0.139      217.77       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   36919.3203



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature  2                           : Bond angle potential                    
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   2773  87A  87A N   CA    680  681  129.65  107.00   22.65    6.51  107.00   22.65    6.51

-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  10700  86L  52D N   O     672  413    6.29    2.95    3.33    7.64    2.95    3.33    7.64
    2  10702  86L  54Q N   O     672  428   12.02    7.81    4.20    4.68    7.81    4.20    4.68

-------------------------------------------------------------------------------------------------

Feature 13                           : Mainchain Omega dihedral restraints     
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6544  87A  87A CA  C     681  683 -132.52 -180.00   47.48    9.49 -180.00   47.48    9.49

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6235   2K   3V C   N      16   18  -59.93  -62.40   39.34    4.84 -125.40  150.07    8.56
    1          3V   3V N   CA     18   19  -81.66  -42.40                  143.30
    2   6236   3V   4S C   N      23   25  143.97 -136.60   79.44    3.19  -72.40  143.65   10.33
    2          4S   4S N   CA     25   26  149.92  151.20                  152.40
    3   6251  18R  19L C   N     141  143   63.50   60.20    6.12    0.23  -63.50  142.96   26.37
    3         19L  19L N   CA    143  144   24.44   29.60                  -41.20
    4   6253  20T  21A C   N     156  158   56.98   55.40    8.77    0.41  -62.50  138.71   28.21
    4         21A  21A N   CA    158  159   29.57   38.20                  -40.90
    5   6254  21A  22Y C   N     161  163   63.99   55.90   14.04    0.71 -124.30 -157.48   16.81
    5         22Y  22Y N   CA    163  164   28.03   39.50                  135.40
    6   6263  30M  31Y C   N     243  245 -133.07  -63.50   69.63   11.87  -63.50   69.63   11.87
    6         31Y  31Y N   CA    245  246  -40.46  -43.40                  -43.40
    7   6265  32T  33I C   N     262  264  -62.43  -63.40    8.91    1.49 -120.60  175.00    7.91
    7         33I  33I N   CA    264  265  -34.75  -43.60                  130.30
    8   6266  33I  34G C   N     270  272  100.74   82.20   28.13    2.13  -62.40  177.87   33.59
    8         34G  34G N   CA    272  273   29.66    8.50                  -41.20
    9   6269  36G  37H C   N     292  294 -150.93  -63.20  111.21   13.18  -63.20  111.21   13.18
    9         37H  37H N   CA    294  295   26.04  -42.30                  -42.30
   10   6270  37H  38Y C   N     302  304   54.50   55.90    6.97    0.59 -124.30 -153.79   11.27
   10         38Y  38Y N   CA    304  305   32.67   39.50                  135.40
   11   6282  49A  50Q C   N     390  392   81.30   55.10   28.88    2.67 -121.10 -166.92    9.53
   11         50Q  50Q N   CA    392  393   28.15   40.30                  139.70
   12   6287  54Q  55L C   N     427  429   68.18  -70.70  150.76   15.05 -108.50 -170.77    9.88
   12         55L  55L N   CA    429  430 -159.73  141.60                  132.50
   13   6293  60N  61N C   N     476  478 -153.16 -119.90   33.43    1.47  -63.20 -163.46   21.18
   13         61N  61N N   CA    478  479  133.65  137.00                  -41.10
   14   6294  61N  62K C   N     484  486 -170.81 -118.00   55.28    1.87  -62.90 -163.87   31.86
   14         62K  62K N   CA    486  487  155.43  139.10                  -40.80
   15   6295  62K  63Y C   N     493  495 -126.54 -124.30   32.60    1.63  -63.50  161.48   28.75
   15         63Y  63Y N   CA    495  496  167.93  135.40                  -43.40
   16   6296  63Y  64A C   N     505  507  -81.90  -68.20   18.16    1.16  -62.50  163.03   27.71
   16         64A  64A N   CA    507  508  157.23  145.30                  -40.90
   17   6297  64A  65P C   N     510  512  -72.18  -58.70   21.80    1.38  -64.50  160.75   12.40
   17         65P  65P N   CA    512  513  -13.37  -30.50                  147.20
   18   6298  65P  66M C   N     517  519 -108.39 -125.60   19.42    0.58  -63.40  177.80   23.44
   18         66M  66M N   CA    519  520  131.51  140.50                  -40.50
   19   6300  67V  68D C   N     532  534 -141.06  -96.50   44.56    1.82  -63.30  172.32   18.29
   19         68D  68D N   CA    534  535  113.78  114.20                  -40.00
   20   6301  68D  69A C   N     540  542 -130.20 -134.00   22.64    1.19  -62.50  178.89   26.95
   20         69A  69A N   CA    542  543  124.68  147.00                  -40.90
   21   6302  69A  70Y C   N     545  547 -136.77 -124.30   22.67    1.72  -63.50  175.86   24.76
   21         70Y  70Y N   CA    547  548  116.47  135.40                  -43.40
   22   6304  71V  72K C   N     564  566 -146.23 -118.00   37.60    1.30  -62.90  176.20   27.86
   22         72K  72K N   CA    566  567  163.94  139.10                  -40.80
   23   6306  73G  74K C   N     577  579  -71.28  -70.20   17.11    1.21  -62.90  161.94   21.50
   23         74K  74K N   CA    579  580  157.47  140.40                  -40.80
   24   6309  76N  77Q C   N     599  601   69.88  -73.00  143.04   10.09  -63.80 -140.39   38.87
   24         77Q  77Q N   CA    601  602  133.93  140.70                  -40.30
   25   6311  78N  79E C   N     616  618  139.57 -117.80  102.68    3.69  -63.60 -121.41   40.03
   25         79E  79E N   CA    618  619  139.89  136.80                  -40.30
   26   6312  79E  80F C   N     625  627  -90.70  -71.40   21.61    1.23  -63.20  167.54   25.12
   26         80F  80F N   CA    627  628  150.43  140.70                  -44.30
   27   6313  80F  81D C   N     636  638 -137.21  -96.50   40.78    1.66  -63.30  168.94   17.94
   27         81D  81D N   CA    638  639  111.91  114.20                  -40.00
   28   6314  81D  82A C   N     644  646 -165.05 -134.00   31.95    1.35  -62.50 -153.16   39.37
   28         82A  82A N   CA    646  647  139.48  147.00                  -40.90
   29   6315  82A  83L C   N     649  651 -132.49 -108.50   51.17    2.91  -63.50  145.85   17.87
   29         83L  83L N   CA    651  652   87.30  132.50                  -41.20
   30   6317  84V  85S C   N     664  666  156.34 -136.60   83.86    2.58  -64.10 -173.69   23.41
   30         85S  85S N   CA    666  667 -158.44  151.20                  -35.00
   31   6320  87A  88Y C   N     683  685   19.94  -63.50   85.19   13.83  -63.50   85.19   13.83
   31         88Y  88Y N   CA    685  686  -60.55  -43.40                  -43.40
   32   6324  91G  92N C   N     713  715  -74.22  -71.20    5.58    0.43  -63.20  179.54   21.86
   32         92N  92N N   CA    715  716  138.10  142.80                  -41.10
   33   6325  92N  93V C   N     721  723  -68.21  -62.40   11.24    1.77 -125.40  174.33    9.75
   33         93V  93V N   CA    723  724  -52.01  -42.40                  143.30
   34   6328  95V  96A C   N     746  748  -64.28  -68.20    4.24    0.40  -62.50  172.20   28.31
   34         96A  96A N   CA    748  749  146.91  145.30                  -40.90
   35   6329  96A  97D C   N     751  753  -73.87  -96.50   39.10    1.64  -63.30  122.77   14.54
   35         97D  97D N   CA    753  754   82.32  114.20                  -40.00
   36   6330  97D  98G C   N     759  761   55.21   78.70   24.36    1.04   82.20  170.31    9.60
   36         98G  98G N   CA    761  762 -159.65 -166.10                    8.50
   37   6331  98G  99W C   N     763  765 -135.75 -124.90   11.03    0.53  -63.00 -171.06   28.51
   37         99W  99W N   CA    765  766  141.43  143.40                  -44.20
   38   6335 102F 103S C   N     800  802 -155.09  -64.10  105.75   13.91  -72.40  144.67    6.61
   38        103S 103S N   CA    802  803  -88.89  -35.00                  152.40
   39   6336 103S 104H C   N     806  808   78.43 -125.60  156.85    5.82  -63.20 -142.93   35.91
   39        104H 104H N   CA    808  809  122.20  138.80                  -42.30
   40   6337 104H 105A C   N     816  818  -72.16  -68.20   52.49    4.37  -62.50  134.21   21.54
   40        105A 105A N   CA    818  819   92.96  145.30                  -40.90
   41   6340 107C 108A C   N     839  841   57.94  -68.20  128.89   11.75   55.40  133.63    8.26
   41        108A 108A N   CA    841  842  171.80  145.30                   38.20
   42   6341 108A 109S C   N     844  846  171.38 -136.60   52.28    2.21  -64.10 -141.98   24.79
   42        109S 109S N   CA    846  847  146.04  151.20                  -35.00
   43   6342 109S 110M C   N     850  852 -135.32 -125.60   27.43    1.46  -63.40  171.19   21.36
   43        110M 110M N   CA    852  853  114.85  140.50                  -40.50
   44   6345 112P 113K C   N     873  875 -146.54 -118.00   44.63    1.64  -62.90  168.08   26.81
   44        113K 113K N   CA    875  876  173.41  139.10                  -40.80
   45   6346 113K 114Y C   N     882  884  -49.81  -98.40   53.63    2.87  -63.50  166.07   25.66
   45        114Y 114Y N   CA    884  885  151.10  128.40                  -43.40
   46   6347 114Y 115R C   N     894  896  -55.16  -72.10   21.20    1.38  -63.00  170.43   23.55
   46        115R 115R N   CA    896  897  129.15  141.90                  -41.10
   47   6348 115R 116N C   N     905  907 -148.27 -119.90   45.61    1.38  -63.20  169.15   25.88
   47        116N 116N N   CA    907  908  172.71  137.00                  -41.10
   48   6349 116N 117A C   N     913  915  -67.33  -68.20    5.53    0.41  -62.50  179.32   29.63
   48        117A 117A N   CA    915  916  139.84  145.30                  -40.90
   49   6350 117A 118G C   N     918  920  158.14 -167.20   36.57    1.01   82.20  172.08   11.82
   49        118G 118G N   CA    920  921  162.92  174.60                    8.50
   50   6351 118G 119G C   N     922  924 -128.10 -167.20   39.75    0.62   82.20 -141.67   16.65
   50        119G 119G N   CA    924  925  167.43  174.60                    8.50
   51   6352 119G 120Q C   N     926  928   51.48  -73.00  130.91    9.98  -63.80 -179.80   23.21
   51        120Q 120Q N   CA    928  929 -178.79  140.70                  -40.30
   52   6354 121V 122L C   N     942  944  -90.96 -108.50   18.22    0.82  -63.50  170.99   22.32
   52        122L 122L N   CA    944  945  127.57  132.50                  -41.20
   53   6355 122L 123Q C   N     950  952  -97.60 -121.10   25.73    1.19  -63.80  172.85   27.22
   53        123Q 123Q N   CA    952  953  150.18  139.70                  -40.30
   54   6357 124G 125L C   N     963  965 -136.39 -108.50   33.84    1.50  -63.50 -177.66   29.83
   54        125L 125L N   CA    965  966  151.66  132.50                  -41.20
   55   6370 137N 138K C   N    1077 1079   64.40   56.60   16.48    1.77  -62.90  158.20   27.45
   55        138K 138K N   CA   1079 1080   53.12   38.60                  -40.80
   56   6373 140V 141S C   N    1100 1102 -150.83 -136.60   18.88    1.04  -64.10 -165.77   12.36
   56        141S 141S N   CA   1102 1103  138.79  151.20                  -35.00
   57   6374 141S 142S C   N    1106 1108 -148.54 -136.60   26.75    1.51  -64.10 -177.09   11.74
   57        142S 142S N   CA   1108 1109  127.26  151.20                  -35.00
   58   6375 142S 143N C   N    1112 1114 -119.80 -119.90    5.67    0.26  -63.20 -178.52   20.13
   58        143N 143N N   CA   1114 1115  131.33  137.00                  -41.10
   59   6376 143N 144S C   N    1120 1122 -118.71 -136.60   20.07    0.62  -64.10 -174.68   11.43
   59        144S 144S N   CA   1122 1123  142.09  151.20                  -35.00
   60   6377 144S 145N C   N    1126 1128  -63.74  -71.20   11.33    0.90  -63.20  167.58   20.98
   60        145N 145N N   CA   1128 1129  151.33  142.80                  -41.10
   61   6378 145N 146Q C   N    1134 1136  174.43 -121.10   68.87    2.18  -63.80 -162.29   35.05
   61        146Q 146Q N   CA   1136 1137  163.93  139.70                  -40.30
   62   6379 146Q 147N C   N    1143 1145  -78.60  -71.20    7.53    0.58  -63.20  178.16   23.13
   62        147N 147N N   CA   1145 1146  141.41  142.80                  -41.10
   63   6380 147N 148N C   N    1151 1153  -67.44  -71.20   11.05    0.81  -63.20  165.76   20.96
   63        148N 148N N   CA   1153 1154  153.19  142.80                  -41.10
   64   6381 148N 149Q C   N    1159 1161 -122.11 -121.10   34.30    1.62  -63.80  156.95   26.16
   64        149Q 149Q N   CA   1161 1162  173.99  139.70                  -40.30
   65   6382 149Q 150T C   N    1168 1170  -63.97  -78.10   21.16    0.75  -63.20  176.15   22.54
   65        150T 150T N   CA   1170 1171  134.04  149.80                  -42.10
   66   6383 150T 151G C   N    1175 1177   79.56   78.70    9.20    0.30   82.20  165.47    8.17
   66        151G 151G N   CA   1177 1178 -156.94 -166.10                    8.50
   67   6384 151G 152G C   N    1179 1181 -164.94 -167.20    3.64    0.14   82.20 -156.82   14.77
   67        152G 152G N   CA   1181 1182  177.46  174.60                    8.50
   68   6385 152G 153M C   N    1183 1185  -73.99  -73.00   24.15    1.62  -63.40  152.74   23.64
   68        153M 153M N   CA   1185 1186  167.12  143.00                  -40.50
   69   6387 154I 155K C   N    1199 1201 -149.84 -118.00   38.63    1.29  -62.90 -179.46   28.64
   69        155K 155K N   CA   1201 1202  160.97  139.10                  -40.80
   70   6389 156M 157Y C   N    1216 1218 -122.91 -124.30   13.49    0.66  -63.50  175.73   25.18
   70        157Y 157Y N   CA   1218 1219  121.98  135.40                  -43.40
   71   6390 157Y 158L C   N    1228 1230 -109.17 -108.50   43.15    2.33  -63.50  150.26   23.68
   71        158L 158L N   CA   1230 1231  175.65  132.50                  -41.20
   72   6393 160I 161G C   N    1252 1254   95.71   78.70   65.70    1.21   82.20  122.68    6.63
   72        161G 161G N   CA   1254 1255  130.44 -166.10                    8.50
   73   6394 161G 162L C   N    1256 1258 -125.75 -108.50   35.13    2.00  -63.50  156.05   19.20
   73        162L 162L N   CA   1258 1259  101.89  132.50                  -41.20
   74   6396 163D 164N C   N    1272 1274  -70.83  -71.20   33.09    2.11  -63.20  151.00   18.47
   74        164N 164N N   CA   1274 1275  109.71  142.80                  -41.10
   75   6400 167K 168A C   N    1299 1301  -69.07  -68.20    2.03    0.13  -62.50  172.09   28.53
   75        168A 168A N   CA   1301 1302  147.13  145.30                  -40.90
   76   6401 168A 169K C   N    1304 1306 -116.85 -118.00   19.65    0.94  -62.90  169.12   19.72
   76        169K 169K N   CA   1306 1307  119.49  139.10                  -40.80
   77   6402 169K 170H C   N    1313 1315 -144.99 -125.60   23.78    0.59  -63.20 -175.72   28.36
   77        170H 170H N   CA   1315 1316  152.57  138.80                  -42.30
   78   6403 170H 171W C   N    1323 1325  -72.14  -71.30    3.91    0.32  -63.00  179.61   21.92
   78        171W 171W N   CA   1325 1326  135.18  139.00                  -44.20
   79   6404 171W 172Y C   N    1337 1339 -134.99 -124.30   22.41    0.88  -63.50  176.61   31.56
   79        172Y 172Y N   CA   1339 1340  155.10  135.40                  -43.40
   80   6405 172Y 173V C   N    1349 1351  -64.93  -62.40    3.12    0.38 -125.40 -173.77   10.41
   80        173V 173V N   CA   1351 1352  -40.56  -42.40                  143.30
   81   6406 173V 174S C   N    1356 1358  -69.43  -72.40   22.09    1.20  -64.10  165.60   11.69
   81        174S 174S N   CA   1358 1359  130.51  152.40                  -35.00
   82   6407 174S 175D C   N    1362 1364 -133.94  -63.30  108.10   17.71  -63.30  108.10   17.71
   82        175D 175D N   CA   1364 1365 -121.83  -40.00                  -40.00
   83   6408 175D 176G C   N    1370 1372 -179.68 -167.20   17.39    0.38   82.20 -156.58   14.28
   83        176G 176G N   CA   1372 1373 -173.30  174.60                    8.50
   84   6409 176G 177V C   N    1374 1376 -137.26 -125.40   40.78    1.69  -62.40  154.61   24.13
   84        177V 177V N   CA   1376 1377 -177.68  143.30                  -42.40
   85   6410 177V 178S C   N    1381 1383   64.94  -64.10  145.50   14.94  -64.10  145.50   14.94
   85        178S 178S N   CA   1383 1384 -102.23  -35.00                  -35.00
   86   6423 190N 191Y C   N    1492 1494   69.31   55.90  161.18   12.28 -124.30  178.54   10.93
   86        191Y 191Y N   CA   1494 1495 -159.88   39.50                  135.40
   87   6436 203D 204T C   N    1604 1606   56.91   55.90    7.25    0.44 -124.80 -149.89   12.74
   87        204T 204T N   CA   1606 1607   32.32   39.50                  143.50
   88   6439 206F 207I C   N    1630 1632 -100.85 -120.60   74.88    3.55  -63.40  108.35   16.69
   88        207I 207I N   CA   1632 1633   58.07  130.30                  -43.60
   89   6445 212A 213E C   N    1674 1676   65.96   54.60   33.71    1.82  -63.60  139.22   23.76
   89        213E 213E N   CA   1676 1677   10.66   42.40                  -40.30
   90   6448 215G 216R C   N    1698 1700  -68.46  -72.10   25.62    1.89  -63.00  157.73   20.95
   90        216R 216R N   CA   1700 1701  116.53  141.90                  -41.10
   91   6449 216R 217K C   N    1709 1711 -115.90 -118.00   10.67    0.54  -62.90  177.72   26.23
   91        217K 217K N   CA   1711 1712  149.56  139.10                  -40.80
   92   6451 218I 219D C   N    1726 1728  -98.07  -96.50   21.75    0.92  -63.30  179.30   20.27
   92        219D 219D N   CA   1728 1729  135.90  114.20                  -40.00
   93   6452 219D 220M C   N    1734 1736 -114.45 -125.60   11.15    0.43  -63.40 -173.49   31.93
   93        220M 220M N   CA   1736 1737  140.11  140.50                  -40.50
   94   6453 220M 221A C   N    1742 1744 -132.41 -134.00    4.97    0.31  -62.50 -178.59   33.47
   94        221A 221A N   CA   1744 1745  151.70  147.00                  -40.90
   95   6454 221A 222S C   N    1747 1749 -125.53 -136.60   11.57    0.55  -64.10 -178.84   17.45
   95        222S 222S N   CA   1749 1750  154.57  151.20                  -35.00
   96   6455 222S 223G C   N    1753 1755  -84.30  -80.20    4.85    0.36   82.20 -126.99    7.37
   96        223G 223G N   CA   1755 1756  171.51  174.10                    8.50
   97   6456 223G 224E C   N    1757 1759  -93.51 -117.80   30.91    0.94  -63.60  160.78   19.94
   97        224E 224E N   CA   1759 1760  117.68  136.80                  -40.30

-------------------------------------------------------------------------------------------------

Feature 27                           : Distance restraints 5 (X-Y)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  13273  86L 228. CA  C7    673 1806    8.99    8.02    0.97    4.86    8.02    0.97    4.86
    2  13274  86L 228. CA  C8    673 1807   10.36    9.16    1.21    6.04    9.16    1.21    6.04
    3  13279  86L 228. CA  O7    673 1813    8.13    6.89    1.24    6.21    6.89    1.24    6.21
    4  13291  87A 228. CA  C6    681 1805    8.67    7.67    0.99    4.97    7.67    0.99    4.97
    5  13297  87A 228. CA  O6    681 1812    7.52    6.36    1.16    5.78    6.36    1.16    5.78
    6  14444  83L 229. CG  O6    654 1826    3.81    3.00    0.81    8.15    3.00    0.81    8.15


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    1   22   31  173  157  228  214  257  293  266  303


<< end of ENERGY.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1827    1827
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    14444   14444
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     4159
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        2159.5608





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1824       0      7   0.010   0.010      51.334       1.000
 2 Bond angle potential               :    2468       3     33   2.526   2.526      296.68       1.000
 3 Stereochemical cosine torsion poten:    1168       0     66  51.089  51.089      472.80       1.000
 4 Stereochemical improper torsion pot:     773       0      3   1.480   1.480      36.856       1.000
 5 Soft-sphere overlap restraints     :    4159       1      4   0.010   0.010      44.728       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2356       0      8   0.653   0.653      182.34       1.000
10 Distance restraints 2 (N-O)        :    2508       3     14   0.777   0.777      267.41       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     225       2      7   5.650   5.650      84.709       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      2  82.758  82.758      59.937       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      2  82.257  82.257      76.323       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      0  81.580  81.580      40.949       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0  81.879  81.879      15.122       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     900       0      0   0.580   0.580      13.585       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     224      99     43  38.700 113.733      293.20       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     177       0      1   1.649   1.649      17.486       1.000
27 Distance restraints 5 (X-Y)        :    1401       9     18   0.133   0.133      206.11       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990002
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   37178.4609



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature  2                           : Bond angle potential                    
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   2491  60N  61N C   N     476  478  140.10  120.00   20.10    4.57  120.00   20.10    4.57
    2   2947 102F 103S C   N     800  802  145.74  120.00   25.74    5.85  120.00   25.74    5.85

-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  10700  86L  52D N   O     672  413    6.95    2.95    4.00    9.16    2.95    4.00    9.16
    2  10701  86L  53S N   O     672  419   10.66    6.96    3.71    5.00    6.96    3.71    5.00
    3  10702  86L  54Q N   O     672  428   12.03    7.81    4.22    4.70    7.81    4.22    4.70

-------------------------------------------------------------------------------------------------

Feature 13                           : Mainchain Omega dihedral restraints     
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6543  86L  86L CA  C     673  678 -146.78 -180.00   33.22    6.64 -180.00   33.22    6.64
    2   6544  87A  87A CA  C     681  683 -142.47 -180.00   37.53    7.50 -180.00   37.53    7.50

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6251  18R  19L C   N     141  143   65.72   60.20    9.40    0.39  -63.50  143.84   26.52
    1         19L  19L N   CA    143  144   21.99   29.60                  -41.20
    2   6253  20T  21A C   N     156  158   57.50   55.40    5.31    0.19  -62.50  141.10   28.68
    2         21A  21A N   CA    158  159   33.32   38.20                  -40.90
    3   6254  21A  22Y C   N     161  163   66.50   55.90   17.62    0.91 -124.30 -158.20   16.74
    3         22Y  22Y N   CA    163  164   25.43   39.50                  135.40
    4   6263  30M  31Y C   N     243  245  -90.90  -63.50   49.47    9.13  -63.50   49.47    9.13
    4         31Y  31Y N   CA    245  246  -84.60  -43.40                  -43.40
    5   6264  31Y  32T C   N     255  257 -134.88 -124.80   57.63    2.77  -63.20  147.45   15.61
    5         32T  32T N   CA    257  258   86.75  143.50                  -42.10
    6   6266  33I  34G C   N     270  272   93.09   82.20   18.11    0.50  -62.40  159.44   29.64
    6         34G  34G N   CA    272  273   -5.96    8.50                  -41.20
    7   6269  36G  37H C   N     292  294 -157.41 -125.60  107.23    4.59  -63.20  122.75   14.33
    7         37H  37H N   CA    294  295   36.39  138.80                  -42.30
    8   6270  37H  38Y C   N     302  304   62.33   55.90   22.49    1.16 -124.30 -150.59   17.35
    8         38Y  38Y N   CA    304  305   17.95   39.50                  135.40
    9   6282  49A  50Q C   N     390  392   82.53   55.10   29.74    2.84 -121.10 -168.30    9.46
    9         50Q  50Q N   CA    392  393   28.81   40.30                  139.70
   10   6287  54Q  55L C   N     427  429   90.57   60.20  149.39   11.52 -108.50  166.67    7.51
   10         55L  55L N   CA    429  430  175.87   29.60                  132.50
   11   6293  60N  61N C   N     476  478 -151.86 -119.90   56.09    3.04  -63.20  159.01   17.12
   11         61N  61N N   CA    478  479   90.90  137.00                  -41.10
   12   6294  61N  62K C   N     484  486 -152.34 -118.00   34.55    1.24  -62.90 -162.29   31.02
   12         62K  62K N   CA    486  487  142.88  139.10                  -40.80
   13   6295  62K  63Y C   N     493  495 -123.34 -124.30   12.04    0.60  -63.50  177.21   25.39
   13         63Y  63Y N   CA    495  496  123.40  135.40                  -43.40
   14   6296  63Y  64A C   N     505  507 -137.38 -134.00    7.54    0.46  -62.50 -166.11   35.78
   14         64A  64A N   CA    507  508  140.26  147.00                  -40.90
   15   6298  65P  66M C   N     517  519 -175.48 -125.60   53.15    1.69  -63.40 -164.11   37.74
   15         66M  66M N   CA    519  520  158.84  140.50                  -40.50
   16   6300  67V  68D C   N     532  534 -104.70  -96.50   25.41    1.06  -63.30  136.58   14.87
   16         68D  68D N   CA    534  535   90.16  114.20                  -40.00
   17   6301  68D  69A C   N     540  542 -117.62 -134.00   29.00    1.08  -62.50  172.98   26.26
   17         69A  69A N   CA    542  543  123.06  147.00                  -40.90
   18   6302  69A  70Y C   N     545  547 -145.48 -124.30   32.62    1.37  -63.50  176.57   32.00
   18         70Y  70Y N   CA    547  548  160.21  135.40                  -43.40
   19   6304  71V  72K C   N     564  566 -110.82 -118.00   17.30    0.90  -62.90  171.21   25.08
   19         72K  72K N   CA    566  567  154.83  139.10                  -40.80
   20   6305  72K  73G C   N     573  575 -156.94 -167.20   34.57    1.19   82.20  179.78   13.65
   20         73G  73G N   CA    575  576  141.59  174.60                    8.50
   21   6306  73G  74K C   N     577  579 -127.19 -118.00   42.11    2.14  -62.90  152.97   17.59
   21         74K  74K N   CA    579  580   98.00  139.10                  -40.80
   22   6307  74K  75A C   N     586  588  172.97 -134.00   85.07    2.92  -62.50  163.27   32.91
   22         75A  75A N   CA    588  589 -146.48  147.00                  -40.90
   23   6308  75A  76N C   N     591  593  -57.22  -71.20   39.71    2.92  -63.20  139.07   17.07
   23         76N  76N N   CA    593  594  179.96  142.80                  -41.10
   24   6309  76N  77Q C   N     599  601  -45.32  -73.00   30.01    1.91  -63.80  170.42   26.04
   24         77Q  77Q N   CA    601  602  129.11  140.70                  -40.30
   25   6310  77Q  78N C   N     608  610 -159.08 -119.90   45.35    1.36  -63.20 -174.26   28.54
   25         78N  78N N   CA    610  611  159.82  137.00                  -41.10
   26   6311  78N  79E C   N     616  618 -110.66 -117.80    9.10    0.28  -63.60  177.80   21.48
   26         79E  79E N   CA    618  619  131.16  136.80                  -40.30
   27   6312  79E  80F C   N     625  627  -84.07  -71.40   14.32    1.18  -63.20  179.55   23.56
   27         80F  80F N   CA    627  628  134.03  140.70                  -44.30
   28   6313  80F  81D C   N     636  638 -115.69  -96.50   19.57    0.80  -63.30  159.25   17.21
   28         81D  81D N   CA    638  639  110.39  114.20                  -40.00
   29   6314  81D  82A C   N     644  646 -131.46 -134.00   12.60    0.65  -62.50 -171.39   28.45
   29         82A  82A N   CA    646  647  134.65  147.00                  -40.90
   30   6315  82A  83L C   N     649  651 -117.01 -108.50   55.09    3.06  -63.50  130.73   16.07
   30         83L  83L N   CA    651  652   78.07  132.50                  -41.20
   31   6317  84V  85S C   N     664  666  160.35 -136.60   73.45    2.24  -64.10 -167.89   23.62
   31         85S  85S N   CA    666  667 -171.13  151.20                  -35.00
   32   6320  87A  88Y C   N     683  685   40.53  -98.40  139.98    5.87  -63.50 -173.62   34.43
   32         88Y  88Y N   CA    685  686  111.24  128.40                  -43.40
   33   6321  88Y  89N C   N     695  697   95.77   55.90   56.16    3.37  -63.20  164.18   26.37
   33         89N  89N N   CA    697  698   -0.05   39.50                  -41.10
   34   6324  91G  92N C   N     713  715 -169.45 -119.90   81.90    2.51  -63.20  157.81   25.32
   34         92N  92N N   CA    715  716 -157.78  137.00                  -41.10
   35   6327  94F  95V C   N     739  741  -62.07  -62.40    6.52    0.81 -125.40  179.34   10.08
   35         95V  95V N   CA    741  742  -48.91  -42.40                  143.30
   36   6328  95V  96A C   N     746  748 -115.91 -134.00   21.71    0.53  -62.50 -176.17   28.04
   36         96A  96A N   CA    748  749  135.01  147.00                  -40.90
   37   6329  96A  97D C   N     751  753   67.46  -96.50  171.16    6.96  -63.30 -155.95   22.34
   37         97D  97D N   CA    753  754  163.35  114.20                  -40.00
   38   6336 103S 104H C   N     806  808  -69.51 -125.60   77.05    3.49  -63.20  126.23   16.18
   38        104H 104H N   CA    808  809 -168.37  138.80                  -42.30
   39   6337 104H 105A C   N     816  818   66.02   55.40   19.35    0.76  -62.50  143.10   29.09
   39        105A 105A N   CA    818  819   22.02   38.20                  -40.90
   40   6339 106Y 107C C   N     833  835 -104.36 -117.90   72.41    2.63  -63.00  118.52   12.41
   40        107C 107C N   CA    835  836   69.97  141.10                  -41.10
   41   6340 107C 108A C   N     839  841  -67.04  -68.20   11.32    0.95   55.40  170.30    9.20
   41        108A 108A N   CA    841  842  156.56  145.30                   38.20
   42   6341 108A 109S C   N     844  846 -160.00 -136.60   32.25    1.03  -64.10  179.39   19.92
   42        109S 109S N   CA    846  847  173.39  151.20                  -35.00
   43   6342 109S 110M C   N     850  852 -105.23 -125.60   26.97    0.81  -63.40  168.60   22.28
   43        110M 110M N   CA    852  853  122.82  140.50                  -40.50
   44   6345 112P 113K C   N     873  875 -120.82 -118.00   44.26    2.11  -62.90  147.75   22.65
   44        113K 113K N   CA    875  876 -176.73  139.10                  -40.80
   45   6346 113K 114Y C   N     882  884 -117.52 -124.30   22.50    1.49  -63.50  168.63   29.49
   45        114Y 114Y N   CA    884  885  156.85  135.40                  -43.40
   46   6347 114Y 115R C   N     894  896  -56.03  -72.10   24.68    1.60  -63.00  164.42   22.68
   46        115R 115R N   CA    896  897  123.17  141.90                  -41.10
   47   6348 115R 116N C   N     905  907 -145.06 -119.90   50.96    1.68  -63.20  160.09   24.56
   47        116N 116N N   CA    907  908 -178.68  137.00                  -41.10
   48   6349 116N 117A C   N     913  915  -62.07  -68.20    6.39    0.48  -62.50  175.64   28.76
   48        117A 117A N   CA    915  916  143.46  145.30                  -40.90
   49   6350 117A 118G C   N     918  920   71.16   78.70   16.15    0.24   82.20  160.71    8.36
   49        118G 118G N   CA    920  921 -151.82 -166.10                    8.50
   50   6351 118G 119G C   N     922  924 -163.72 -167.20   15.64    0.56   82.20 -170.87   14.02
   50        119G 119G N   CA    924  925  159.35  174.60                    8.50
   51   6352 119G 120Q C   N     926  928 -119.90 -121.10   11.84    0.58  -63.80  177.32   29.06
   51        120Q 120Q N   CA    928  929  151.48  139.70                  -40.30
   52   6354 121V 122L C   N     942  944  -88.13 -108.50   42.27    2.03  -63.50  138.86   18.02
   52        122L 122L N   CA    944  945   95.46  132.50                  -41.20
   53   6355 122L 123Q C   N     950  952 -161.51 -121.10   54.73    1.75  -63.80  173.27   30.38
   53        123Q 123Q N   CA    952  953  176.61  139.70                  -40.30
   54   6356 123Q 124G C   N     959  961   93.32   78.70   41.51    0.66   82.20  146.97    7.69
   54        124G 124G N   CA    961  962  155.05 -166.10                    8.50
   55   6357 124G 125L C   N     963  965 -116.84 -108.50   10.97    0.61  -63.50  174.91   21.88
   55        125L 125L N   CA    965  966  125.37  132.50                  -41.20
   56   6358 125L 126V C   N     971  973   65.84  -73.50  139.43    9.97 -125.40  168.76    6.57
   56        126V 126V N   CA    973  974  144.10  139.20                  143.30
   57   6368 135L 136F C   N    1058 1060 -102.71 -124.20   70.68    3.76  -63.20  112.24   18.19
   57        136F 136F N   CA   1060 1061 -149.36  143.30                  -44.30
   58   6370 137N 138K C   N    1077 1079  -90.19  -70.20   20.13    1.52  -62.90 -179.10   22.14
   58        138K 138K N   CA   1079 1080  138.03  140.40                  -40.80
   59   6373 140V 141S C   N    1100 1102 -126.64 -136.60   10.32    0.35  -64.10 -172.74   17.96
   59        141S 141S N   CA   1102 1103  148.49  151.20                  -35.00
   60   6375 142S 143N C   N    1112 1114 -151.75 -119.90   35.22    1.10  -63.20 -171.10   28.58
   60        143N 143N N   CA   1114 1115  152.04  137.00                  -41.10
   61   6376 143N 144S C   N    1120 1122 -149.06 -136.60   19.83    1.12  -64.10 -169.26   12.14
   61        144S 144S N   CA   1122 1123  135.78  151.20                  -35.00
   62   6377 144S 145N C   N    1126 1128 -146.31 -119.90   27.92    1.37  -63.20 -171.61   20.34
   62        145N 145N N   CA   1128 1129  127.96  137.00                  -41.10
   63   6378 145N 146Q C   N    1134 1136 -165.42 -121.10   52.67    1.62  -63.80 -177.55   31.94
   63        146Q 146Q N   CA   1136 1137  168.16  139.70                  -40.30
   64   6379 146Q 147N C   N    1143 1145  -77.24  -71.20   49.60    3.35  -63.20  135.39   16.19
   64        147N 147N N   CA   1145 1146   93.57  142.80                  -41.10
   65   6380 147N 148N C   N    1151 1153 -138.91 -119.90   20.73    0.66  -63.20 -170.58   27.97
   65        148N 148N N   CA   1153 1154  145.27  137.00                  -41.10
   66   6381 148N 149Q C   N    1159 1161 -128.64 -121.10   41.75    2.10  -63.80  153.32   19.89
   66        149Q 149Q N   CA   1161 1162   98.63  139.70                  -40.30
   67   6382 149Q 150T C   N    1168 1170 -157.49 -124.80   36.16    1.46  -63.20 -175.19   29.73
   67        150T 150T N   CA   1170 1171  158.96  143.50                  -42.10
   68   6383 150T 151G C   N    1175 1177   64.73   78.70   18.28    0.47   82.20  163.75    8.82
   68        151G 151G N   CA   1177 1178 -154.32 -166.10                    8.50
   69   6384 151G 152G C   N    1179 1181  158.81 -167.20   34.09    0.71   82.20 -179.45   12.28
   69        152G 152G N   CA   1181 1182  171.99  174.60                    8.50
   70   6385 152G 153M C   N    1183 1185  -79.14  -73.00   31.77    2.26  -63.40  153.14   21.68
   70        153M 153M N   CA   1185 1186  111.82  143.00                  -40.50
   71   6388 155K 156M C   N    1208 1210 -112.48 -125.60   34.43    1.33  -63.40  157.04   20.22
   71        156M 156M N   CA   1210 1211  108.67  140.50                  -40.50
   72   6389 156M 157Y C   N    1216 1218  -75.07  -98.40   23.63    0.94  -63.50  175.97   27.33
   72        157Y 157Y N   CA   1218 1219  132.18  128.40                  -43.40
   73   6390 157Y 158L C   N    1228 1230  -87.31 -108.50   21.86    0.99  -63.50  170.01   22.35
   73        158L 158L N   CA   1230 1231  127.13  132.50                  -41.20
   74   6394 161G 162L C   N    1256 1258  -70.51  -70.70    0.20    0.02  -63.50  177.27   25.02
   74        162L 162L N   CA   1258 1259  141.67  141.60                  -41.20
   75   6395 162L 163D C   N    1264 1266  -93.65  -70.90   37.06    1.33  -63.30  143.69   19.68
   75        163D 163D N   CA   1266 1267  179.56  150.30                  -40.00
   76   6396 163D 164N C   N    1272 1274  -89.42  -71.20   49.48    3.66  -63.20  140.36   16.24
   76        164N 164N N   CA   1274 1275   96.79  142.80                  -41.10
   77   6399 166G 167K C   N    1290 1292  -90.85  -70.20   23.53    1.46  -62.90  169.83   23.68
   77        167K 167K N   CA   1292 1293  151.69  140.40                  -40.80
   78   6400 167K 168A C   N    1299 1301  -95.83  -68.20   33.41    3.28  -62.50  170.71   26.54
   78        168A 168A N   CA   1301 1302  126.52  145.30                  -40.90
   79   6401 168A 169K C   N    1304 1306 -162.06 -118.00   44.67    1.57  -62.90 -160.79   31.78
   79        169K 169K N   CA   1306 1307  146.43  139.10                  -40.80
   80   6402 169K 170H C   N    1313 1315 -107.78 -125.60   51.58    1.59  -63.20  139.98   15.28
   80        170H 170H N   CA   1315 1316   90.39  138.80                  -42.30
   81   6403 170H 171W C   N    1323 1325 -142.09 -124.90   19.37    0.65  -63.00 -178.39   28.03
   81        171W 171W N   CA   1325 1326  152.32  143.40                  -44.20
   82   6404 171W 172Y C   N    1337 1339 -133.66 -124.30   20.19    0.79  -63.50  177.75   31.69
   82        172Y 172Y N   CA   1339 1340  153.28  135.40                  -43.40
   83   6405 172Y 173V C   N    1349 1351  -61.10  -62.40    4.99    0.57 -125.40 -178.74   10.20
   83        173V 173V N   CA   1351 1352  -47.22  -42.40                  143.30
   84   6406 173V 174S C   N    1356 1358  -86.07  -72.40   15.68    0.85  -64.10  166.36   13.48
   84        174S 174S N   CA   1358 1359  160.09  152.40                  -35.00
   85   6407 174S 175D C   N    1362 1364 -102.27  -96.50   12.21    0.51  -63.30  169.50   18.90
   85        175D 175D N   CA   1364 1365  124.96  114.20                  -40.00
   86   6408 175D 176G C   N    1370 1372  157.36 -167.20   99.44    4.09   82.20  104.90    8.06
   86        176G 176G N   CA   1372 1373   81.68  174.60                    8.50
   87   6409 176G 177V C   N    1374 1376 -110.80 -125.40   75.18    3.34  -62.40  121.97   13.43
   87        177V 177V N   CA   1376 1377   69.56  143.30                  -42.40
   88   6423 190N 191Y C   N    1492 1494   70.79   55.90  162.38   12.48 -124.30  177.55   10.80
   88        191Y 191Y N   CA   1494 1495 -158.80   39.50                  135.40
   89   6436 203D 204T C   N    1604 1606   49.88   55.90    8.48    0.51 -124.80 -159.70    7.71
   89        204T 204T N   CA   1606 1607   45.48   39.50                  143.50
   90   6439 206F 207I C   N    1630 1632 -105.27  -63.40   92.07   14.04  -63.40   92.07   14.04
   90        207I 207I N   CA   1632 1633   38.40  -43.60                  -43.60
   91   6445 212A 213E C   N    1674 1676   62.66   54.60   23.92    1.29  -63.60  139.87   24.00
   91        213E 213E N   CA   1676 1677   19.88   42.40                  -40.30
   92   6448 215G 216R C   N    1698 1700   46.84   57.30   22.63    1.11  -63.00  147.98   26.67
   92        216R 216R N   CA   1700 1701   58.07   38.00                  -41.10
   93   6449 216R 217K C   N    1709 1711  -49.68  -70.20   20.54    1.47  -62.90 -179.62   22.73
   93        217K 217K N   CA   1711 1712  139.30  140.40                  -40.80
   94   6451 218I 219D C   N    1726 1728  -71.40  -70.90   12.11    0.57  -63.30  157.82   19.98
   94        219D 219D N   CA   1728 1729  162.39  150.30                  -40.00
   95   6452 219D 220M C   N    1734 1736  -69.34  -73.00   18.39    1.19  -63.40  165.58   24.27
   95        220M 220M N   CA   1736 1737  124.98  143.00                  -40.50
   96   6453 220M 221A C   N    1742 1744  -84.54  -68.20   19.38    1.28  -62.50  164.85   28.15
   96        221A 221A N   CA   1744 1745  155.73  145.30                  -40.90
   97   6454 221A 222S C   N    1747 1749 -121.03 -136.60   18.97    0.58  -64.10 -175.64   11.36
   97        222S 222S N   CA   1749 1750  140.35  151.20                  -35.00
   98   6455 222S 223G C   N    1753 1755 -144.00 -167.20   32.09    0.70   82.20 -163.49   14.96
   98        223G 223G N   CA   1755 1756  152.42  174.60                    8.50
   99   6456 223G 224E C   N    1757 1759 -131.49 -117.80   16.63    0.49  -63.60 -173.72   28.67
   99        224E 224E N   CA   1759 1760  146.24  136.80                  -40.30

-------------------------------------------------------------------------------------------------

Feature 27                           : Distance restraints 5 (X-Y)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  13273  86L 228. CA  C7    673 1806    9.10    8.02    1.08    5.42    8.02    1.08    5.42
    2  13274  86L 228. CA  C8    673 1807   10.46    9.16    1.30    6.51    9.16    1.30    6.51
    3  13279  86L 228. CA  O7    673 1813    8.20    6.89    1.32    6.59    6.89    1.32    6.59
    4  13297  87A 228. CA  O6    681 1812    7.30    6.36    0.94    4.68    6.36    0.94    4.68
    5  14444  83L 229. CG  O6    654 1826    3.93    3.00    0.93    9.33    3.00    0.93    9.33


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    1   31   31  164  179  227  180  234  277  286  305


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
P62693.B99990001.pdb          2114.73804
P62693.B99990002.pdb          2159.56079

In [ ]:
from IPython.display import Image
Image('1.png')
Out[ ]:
No description has been provided for this image
In [ ]:
#Постройте структуру лизоцима с лигандом где все аминокислоты аланин
#и сравните скор функцию с "нативной" последовательностью.
In [ ]:
def evaluate_model(pdb_file):
    mdl = complete_pdb(env, pdb_file)
    atmsel = selection(mdl)
    # Используем DOPE score (чем ниже, тем стабильнее модель)
    return atmsel.assess_dope()

# 1. Считаем скор для нативной модели
score_native = evaluate_model('P62693_ligand.B99990001.pdb')

# 2. Запускаем моделирование для Poly-ALA (нужно создать новый объект a_ala)
# Предположим, вы создали файл 'poly_ala.ali'
a_ala = mymodel(env, alnfile='poly_ala.ali', knowns='1lmp', sequence='P62693_ALA')
a_ala.make()
score_ala = evaluate_model('P62693_ALA.B99990001.pdb')

print(f"Native DOPE score: {score_native}")
print(f"Poly-ALA DOPE score: {score_ala}")
In [ ]:
from modeller.scripts import complete_pdb
In [ ]:
def evaluate_model(pdb_file):
    mdl = complete_pdb(env, pdb_file)
    atmsel = selection(mdl)
    return atmsel.assess_dope()
In [ ]:
score_native = evaluate_model('P62693.B99990001.pdb')
readlinef__W> File: P62693.B99990001.pdb, Line: 6
              Modeller will only read the first 80 characters of this line.

selection__W> The class 'selection' is deprecated; use 'Selection' instead
>> Model assessment by DOPE potential
iatmcls_286W> MODEL atom not classified:  LYS:OXT  LYS
preppdf_453W> No fixed restraints selected; there may be some dynamic ones.
preppdf_454W> Restraints file was probably not read; use restraints.append().


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1827    1827
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :        0       0
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):   326018
Dynamic pairs routine                             : 1, NATM x NATM double loop
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        1    9999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :   15.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       F       F       F       T
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :      -15983.8193




<< end of ENERGY.
DOPE score               : -15983.819336
In [ ]:
%%writefile all_in_one_3.ali
>P1;P62693
sequence::: :: :::-1.00:-1.00
MKVSQNGLNLIKEFEGCRLTAYKPVP-WEQMYTIGWGHYGVTAGTTWTQAQADSQLEIDINNKYAPMVDAYVKGK
ANQNEFDALVSLAYNCGNVFVADGWAPFSHAYCASMIPKYRNAGGQVLQGLVRRRQAELNLFNKPVSSNSNQNNQ
TGGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKLNLPVDTMFIAEIEAEFGRKIDMASGE
VK/AAA*

>P1;1lmp
structureX:1lmp:1:A:3:B::::
KVYDRCELARALKASGMDGYAGNSLPNWVCLS--KWESSYNTQATNRNTDGSTDYGIFQIN--------------
-----------SRYWCD-----DGRTPGAKNVCG-----------------IRCSQLLTDDLT------------
---------------------------VAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV--------
--/...*
Overwriting all_in_one_3.ali
In [ ]:
class mymodel(AutoModel):
    def special_constraints(self, aln):
         pass
    def special_restraints(self, aln):
        rsr = self.restraints
        at = self.atoms
        for x,y in [('CG:83:A','C:228:B')]:
         rsr.add(modeller.forms.gaussian(group=modeller.physical.xy_distance,
                                            feature=modeller.features.distance(
                                            at[x],at[y]),mean=3.0, stdev=0.1))
from modeller import *
from modeller.automodel import *
a = mymodel(env, alnfile='all_in_one_3.ali', knowns='1lmp', sequence='P62693')
a.name='P62693_ligand'
a.starting_model = 1
a.ending_model = 2
a.make()
AutoModel__W> Topology and/or parameter libraries already in memory. These will
                be used instead of the AutoModel defaults. If this is not what you
                want, clear them before creating the AutoModel object with
                env.libs.topology.clear() and env.libs.parameters.clear()
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied intrachain target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
transfe_404W> At least one template is aligned with model residue  227:B
              but no coordinates could be transferred. This usually
              occurs when your input files do not use the official
              PDBv3 atom names. Please check your templates.
transfe_404W> At least one template is aligned with model residue  228:B
              but no coordinates could be transferred. This usually
              occurs when your input files do not use the official
              PDBv3 atom names. Please check your templates.
transfe_404W> At least one template is aligned with model residue  229:B
              but no coordinates could be transferred. This usually
              occurs when your input files do not use the official
              PDBv3 atom names. Please check your templates.
buildc__466W> Some coordinates in MODEL not assigned.
buildc__468W> Some coordinates in MODEL are still undefined.
buildc__466W> Some coordinates in MODEL not assigned.
buildc__468W> Some coordinates in MODEL are still undefined.
invent__526W> Inventing the mainchain model coordinates.
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
0 atoms in HETATM/BLK residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
0 atoms in residues without defined topology
constrained to be rigid bodies
distance___W> The class 'distance' is deprecated; use 'Distance' instead
gaussian___W> The class 'gaussian' is deprecated; use 'Gaussian' instead
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    14695    13098
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_484W> Dihedral still outside +-90:      -90.6178
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1800    1800
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    13098   13098
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     3616
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        1450.6034





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1839       0      0   0.004   0.004      9.8290       1.000
 2 Bond angle potential               :    2488       0      1   1.962   1.962      179.79       1.000
 3 Stereochemical cosine torsion poten:    1178       0     43  48.709  48.709      433.87       1.000
 4 Stereochemical improper torsion pot:     779       0      0   1.096   1.096      19.551       1.000
 5 Soft-sphere overlap restraints     :    3616       0      0   0.004   0.004      5.5238       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2356       0      0   0.500   0.500      92.666       1.000
10 Distance restraints 2 (N-O)        :    2508       0      2   0.741   0.741      187.00       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     227       0      1   4.294   4.294      49.357       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      4  79.983  79.983      73.780       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      0  75.335  75.335      71.093       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      0  82.192  82.192      44.151       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0 107.959 107.959      18.435       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     900       0      0   0.418   0.418      11.422       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     225      96     43  34.515 110.897      245.61       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     177       0      0   1.109   1.109      8.2811       1.000
27 Distance restraints 5 (X-Y)        :       1       0      0   0.091   0.091     0.24599       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   33946.4492



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6302  18R  19L C   N     141  143   67.65   60.20   18.71    0.65  -63.50  141.70   26.05
    1         19L  19L N   CA    143  144   12.43   29.60                  -41.20
    2   6304  20T  21A C   N     156  158   55.78   55.40    4.17    0.22  -62.50  140.03   28.46
    2         21A  21A N   CA    158  159   34.05   38.20                  -40.90
    3   6305  21A  22Y C   N     161  163   61.43   55.90    9.12    0.48 -124.30 -157.49   16.82
    3         22Y  22Y N   CA    163  164   32.26   39.50                  135.40
    4   6314  30M  31Y C   N     243  245  -51.85  -98.40   59.52    4.14  -63.50  151.55   23.46
    4         31Y  31Y N   CA    245  246  165.50  128.40                  -43.40
    5   6317  33I  34G C   N     270  272   89.24   78.70   22.58    1.05  -62.40 -175.59   27.38
    5         34G  34G N   CA    272  273 -146.14 -166.10                  -41.20
    6   6318  34G  35W C   N     274  276  -67.83  -71.30   33.32    2.61  -63.00  143.75   18.27
    6         35W  35W N   CA    276  277  172.14  139.00                  -44.20
    7   6319  35W  36G C   N     288  290   95.28   78.70   59.58    2.36  -62.40  171.59   27.23
    7         36G  36G N   CA    290  291 -108.88 -166.10                  -41.20
    8   6320  36G  37H C   N     292  294 -145.61 -125.60   83.14    3.50  -63.20  129.90   14.15
    8         37H  37H N   CA    294  295   58.11  138.80                  -42.30
    9   6321  37H  38Y C   N     302  304   41.73   55.90   15.15    1.37 -124.30 -170.90   10.52
    9         38Y  38Y N   CA    304  305   44.88   39.50                  135.40
   10   6333  49A  50Q C   N     390  392   83.37   55.10   41.33    2.49 -121.10 -157.58   10.19
   10         50Q  50Q N   CA    392  393   10.15   40.30                  139.70
   11   6338  54Q  55L C   N     427  429   92.48   60.20  152.09   11.85 -108.50  165.47    7.44
   11         55L  55L N   CA    429  430  178.22   29.60                  132.50
   12   6344  60N  61N C   N     476  478 -137.48 -119.90   47.69    1.72  -63.20  156.34   23.70
   12         61N  61N N   CA    478  479 -178.67  137.00                  -41.10
   13   6345  61N  62K C   N     484  486 -121.93 -118.00   20.70    0.94  -62.90  170.33   25.65
   13         62K  62K N   CA    486  487  159.42  139.10                  -40.80
   14   6346  62K  63Y C   N     493  495  -60.94  -98.40   39.46    1.84  -63.50  175.82   27.77
   14         63Y  63Y N   CA    495  496  140.80  128.40                  -43.40
   15   6347  63Y  64A C   N     505  507  -55.73  -68.20   14.00    0.96  -62.50  179.96   29.83
   15         64A  64A N   CA    507  508  138.94  145.30                  -40.90
   16   6349  65P  66M C   N     517  519  -84.70  -73.00   13.11    1.05  -63.40  178.84   25.11
   16         66M  66M N   CA    519  520  137.07  143.00                  -40.50
   17   6352  68D  69A C   N     540  542 -131.38 -134.00    4.63    0.28  -62.50 -178.17   33.49
   17         69A  69A N   CA    542  543  150.82  147.00                  -40.90
   18   6353  69A  70Y C   N     545  547  -98.97  -98.40   12.91    1.37  -63.50  178.86   30.20
   18         70Y  70Y N   CA    547  548  141.30  128.40                  -43.40
   19   6355  71V  72K C   N     564  566 -107.09 -118.00   15.09    0.53  -62.90  175.14   20.75
   19         72K  72K N   CA    566  567  128.68  139.10                  -40.80
   20   6356  72K  73G C   N     573  575 -157.74 -167.20   11.28    0.20   82.20 -160.02   14.81
   20         73G  73G N   CA    575  576  168.44  174.60                    8.50
   21   6357  73G  74K C   N     577  579 -112.46 -118.00    9.75    0.37  -62.90  178.88   21.06
   21         74K  74K N   CA    579  580  131.08  139.10                  -40.80
   22   6358  74K  75A C   N     586  588 -119.47 -134.00   15.06    0.37  -62.50 -174.97   33.36
   22         75A  75A N   CA    588  589  143.06  147.00                  -40.90
   23   6359  75A  76N C   N     591  593 -134.06 -119.90   21.21    0.63  -63.20 -179.40   26.59
   23         76N  76N N   CA    593  594  152.78  137.00                  -41.10
   24   6360  76N  77Q C   N     599  601  -82.86  -73.00   57.36    3.95  -63.80  125.95   17.57
   24         77Q  77Q N   CA    601  602   84.19  140.70                  -40.30
   25   6361  77Q  78N C   N     608  610 -141.09 -119.90   46.37    1.57  -63.20  160.78   24.45
   25         78N  78N N   CA    610  611  178.25  137.00                  -41.10
   26   6362  78N  79E C   N     616  618  -69.71  -69.30    8.34    0.62  -63.60  168.98   22.87
   26         79E  79E N   CA    618  619  150.83  142.50                  -40.30
   27   6363  79E  80F C   N     625  627 -119.31 -124.20   13.46    0.73  -63.20  169.42   27.24
   27         80F  80F N   CA    627  628  155.84  143.30                  -44.30
   28   6364  80F  81D C   N     636  638  -71.20  -96.50   25.83    1.06  -63.30  149.18   17.95
   28         81D  81D N   CA    638  639  108.97  114.20                  -40.00
   29   6365  81D  82A C   N     644  646 -140.76 -134.00    7.20    0.17  -62.50 -173.17   34.81
   29         82A  82A N   CA    646  647  149.46  147.00                  -40.90
   30   6366  82A  83L C   N     649  651  -87.97  -70.70   36.37    2.26  -63.50  147.24   21.92
   30         83L  83L N   CA    651  652  173.61  141.60                  -41.20
   31   6368  84V  85S C   N     664  666 -178.65 -136.60   43.90    1.45  -64.10 -162.24   22.60
   31         85S  85S N   CA    666  667  163.79  151.20                  -35.00
   32   6371  87A  88Y C   N     683  685 -136.83 -124.30   23.05    0.91  -63.50  177.69   31.82
   32         88Y  88Y N   CA    685  686  154.75  135.40                  -43.40
   33   6372  88Y  89N C   N     695  697   65.83   55.90   24.53    1.18  -63.20  141.54   23.18
   33         89N  89N N   CA    697  698   17.07   39.50                  -41.10
   34   6375  91G  92N C   N     713  715 -168.82 -119.90   55.73    1.70  -63.20 -172.24   29.27
   34         92N  92N N   CA    715  716  163.68  137.00                  -41.10
   35   6376  92N  93V C   N     721  723  -67.80  -62.40   10.40    1.14 -125.40 -174.04    7.59
   35         93V  93V N   CA    723  724  -33.51  -42.40                  143.30
   36   6377  93V  94F C   N     728  730  -81.26  -63.20   88.15   13.46  -63.20   88.15   13.46
   36         94F  94F N   CA    730  731 -130.58  -44.30                  -44.30
   37   6378  94F  95V C   N     739  741  -58.58  -62.40    7.17    1.14 -125.40 -168.34    7.58
   37         95V  95V N   CA    741  742  -36.33  -42.40                  143.30
   38   6379  95V  96A C   N     746  748  -63.50  -68.20   23.54    2.06  -62.50  150.74   24.75
   38         96A  96A N   CA    748  749  168.37  145.30                  -40.90
   39   6380  96A  97D C   N     751  753  -55.07  -96.50   50.05    2.08  -63.30  126.37   16.11
   39         97D  97D N   CA    753  754   86.11  114.20                  -40.00
   40   6381  97D  98G C   N     759  761  -74.56  -62.40   12.39    2.10   82.20  163.75   12.34
   40         98G  98G N   CA    761  762  -38.81  -41.20                    8.50
   41   6387 103S 104H C   N     806  808 -101.04  -63.20   78.90   12.31  -63.20   78.90   12.31
   41        104H 104H N   CA    808  809 -111.53  -42.30                  -42.30
   42   6388 104H 105A C   N     816  818 -151.97 -134.00   18.69    0.46  -62.50 -170.58   35.83
   42        105A 105A N   CA    818  819  152.14  147.00                  -40.90
   43   6389 105A 106Y C   N     821  823  -55.99  -98.40   53.78    3.70  -63.50  155.31   24.26
   43        106Y 106Y N   CA    823  824  161.47  128.40                  -43.40
   44   6390 106Y 107C C   N     833  835  -70.00 -117.90   74.70    2.12  -63.00  125.07   14.79
   44        107C 107C N   CA    835  836   83.78  141.10                  -41.10
   45   6391 107C 108A C   N     839  841  -88.69  -68.20   45.39    4.30   55.40  158.74   12.90
   45        108A 108A N   CA    841  842  104.80  145.30                   38.20
   46   6392 108A 109S C   N     844  846 -105.31  -72.40   54.19    2.48  -64.10  135.94   12.72
   46        109S 109S N   CA    846  847 -164.55  152.40                  -35.00
   47   6393 109S 110M C   N     850  852  -62.98  -73.00   10.12    0.74  -63.40  177.88   26.52
   47        110M 110M N   CA    852  853  141.62  143.00                  -40.50
   48   6396 112P 113K C   N     873  875  -84.61  -70.20   33.92    2.13  -62.90  149.68   20.69
   48        113K 113K N   CA    875  876  171.10  140.40                  -40.80
   49   6397 113K 114Y C   N     882  884 -138.63 -124.30   57.00    2.47  -63.50  146.73   26.86
   49        114Y 114Y N   CA    884  885 -169.43  135.40                  -43.40
   50   6398 114Y 115R C   N     894  896  -63.58  -72.10   28.54    2.36  -63.00  149.77   20.27
   50        115R 115R N   CA    896  897  169.13  141.90                  -41.10
   51   6399 115R 116N C   N     905  907  -51.61  -71.20   20.84    1.31  -63.20  177.16   22.79
   51        116N 116N N   CA    907  908  135.68  142.80                  -41.10
   52   6400 116N 117A C   N     913  915 -140.46 -134.00   14.59    0.62  -62.50  177.11   33.20
   52        117A 117A N   CA    915  916  160.08  147.00                  -40.90
   53   6401 117A 118G C   N     918  920  -67.05  -62.40    6.26    0.89   82.20  156.03   11.77
   53        118G 118G N   CA    920  921  -37.01  -41.20                    8.50
   54   6406 122L 123Q C   N     950  952  -52.70  -73.00   25.68    2.00  -63.80  163.65   23.49
   54        123Q 123Q N   CA    952  953  156.43  140.70                  -40.30
   55   6407 123Q 124G C   N     959  961  173.81 -167.20   19.02    0.39   82.20 -171.27   13.27
   55        124G 124G N   CA    961  962  173.51  174.60                    8.50
   56   6408 124G 125L C   N     963  965  -85.45  -70.70   30.35    1.89  -63.50  152.27   22.46
   56        125L 125L N   CA    965  966  168.12  141.60                  -41.20
   57   6421 137N 138K C   N    1077 1079 -160.37 -118.00   57.71    2.01  -62.90  171.34   28.01
   57        138K 138K N   CA   1079 1080  178.29  139.10                  -40.80
   58   6424 140V 141S C   N    1100 1102 -134.38 -136.60   22.46    1.09  -64.10  178.28   11.10
   58        141S 141S N   CA   1102 1103  128.85  151.20                  -35.00
   59   6425 141S 142S C   N    1106 1108 -107.85 -136.60   31.04    0.98  -64.10  179.90   11.22
   59        142S 142S N   CA   1108 1109  139.50  151.20                  -35.00
   60   6426 142S 143N C   N    1112 1114 -156.88 -119.90   37.10    1.61  -63.20 -161.27   21.39
   60        143N 143N N   CA   1114 1115  134.16  137.00                  -41.10
   61   6427 143N 144S C   N    1120 1122  -64.79  -72.40   17.49    0.82  -64.10  171.65   12.40
   61        144S 144S N   CA   1122 1123  136.65  152.40                  -35.00
   62   6428 144S 145N C   N    1126 1128 -129.22 -119.90    9.81    0.33  -63.20 -169.35   27.59
   62        145N 145N N   CA   1128 1129  140.05  137.00                  -41.10
   63   6429 145N 146Q C   N    1134 1136 -103.40 -121.10   61.07    2.56  -63.80  127.84   17.00
   63        146Q 146Q N   CA   1136 1137   81.26  139.70                  -40.30
   64   6430 146Q 147N C   N    1143 1145 -127.27 -119.90    7.41    0.33  -63.20 -171.43   20.76
   64        147N 147N N   CA   1145 1146  136.25  137.00                  -41.10
   65   6431 147N 148N C   N    1151 1153  -94.14 -119.90   57.99    1.98  -63.20  129.88   14.75
   65        148N 148N N   CA   1153 1154   85.04  137.00                  -41.10
   66   6432 148N 149Q C   N    1159 1161 -147.32 -121.10   26.32    0.94  -63.80 -163.66   33.24
   66        149Q 149Q N   CA   1161 1162  142.01  139.70                  -40.30
   67   6433 149Q 150T C   N    1168 1170 -106.96 -124.80   67.24    2.38  -63.20  128.45   14.07
   67        150T 150T N   CA   1170 1171   78.66  143.50                  -42.10
   68   6434 150T 151G C   N    1175 1177   58.97   78.70   21.08    0.83   82.20  168.78    9.35
   68        151G 151G N   CA   1177 1178 -158.67 -166.10                    8.50
   69   6435 151G 152G C   N    1179 1181  139.91 -167.20   55.77    1.53   82.20  159.23   10.44
   69        152G 152G N   CA   1181 1182  156.91  174.60                    8.50
   70   6438 154I 155K C   N    1199 1201  -73.52  -70.20    3.44    0.23  -62.90  178.23   23.74
   70        155K 155K N   CA   1201 1202  141.29  140.40                  -40.80
   71   6439 155K 156M C   N    1208 1210  -97.15  -73.00   46.24    2.88  -63.40  141.17   23.78
   71        156M 156M N   CA   1210 1211 -177.58  143.00                  -40.50
   72   6441 157Y 158L C   N    1228 1230 -142.09 -108.50   33.83    1.66  -63.50 -173.00   22.96
   72        158L 158L N   CA   1230 1231  128.48  132.50                  -41.20
   73   6444 160I 161G C   N    1252 1254  103.71   78.70   36.83    0.77   82.20  159.81    8.83
   73        161G 161G N   CA   1254 1255  166.86 -166.10                    8.50
   74   6445 161G 162L C   N    1256 1258  -76.32  -70.70   44.78    3.61  -63.50  138.97   18.60
   74        162L 162L N   CA   1258 1259   97.18  141.60                  -41.20
   75   6446 162L 163D C   N    1264 1266 -143.10  -96.50   51.44    2.09  -63.30  154.61   16.44
   75        163D 163D N   CA   1266 1267   92.43  114.20                  -40.00
   76   6447 163D 164N C   N    1272 1274 -119.03 -119.90   24.63    1.14  -63.20  166.90   24.04
   76        164N 164N N   CA   1274 1275  161.61  137.00                  -41.10
   77   6448 164N 165S C   N    1280 1282 -131.87 -136.60   33.78    1.80  -64.10  155.86   16.14
   77        165S 165S N   CA   1282 1283 -175.36  151.20                  -35.00
   78   6451 167K 168A C   N    1299 1301  164.46 -134.00   61.76    2.24  -62.50 -138.41   43.30
   78        168A 168A N   CA   1301 1302  141.89  147.00                  -40.90
   79   6452 168A 169K C   N    1304 1306 -105.52 -118.00   51.99    2.33  -62.90  136.27   15.91
   79        169K 169K N   CA   1306 1307   88.64  139.10                  -40.80
   80   6453 169K 170H C   N    1313 1315 -138.01 -125.60   29.41    0.86  -63.20  169.63   26.07
   80        170H 170H N   CA   1315 1316  165.46  138.80                  -42.30
   81   6457 173V 174S C   N    1356 1358 -129.23 -136.60   24.77    1.08  -64.10  175.12   10.84
   81        174S 174S N   CA   1358 1359  127.55  151.20                  -35.00
   82   6458 174S 175D C   N    1362 1364  -74.06  -70.90    5.93    0.44  -63.30  175.05   22.27
   82        175D 175D N   CA   1364 1365  145.28  150.30                  -40.00
   83   6459 175D 176G C   N    1370 1372  148.91 -167.20   75.98    3.01   82.20  123.62    8.92
   83        176G 176G N   CA   1372 1373  112.58  174.60                    8.50
   84   6474 190N 191Y C   N    1492 1494   72.49   55.90  155.88   12.15 -124.30  173.58   10.80
   84        191Y 191Y N   CA   1494 1495 -165.50   39.50                  135.40
   85   6487 203D 204T C   N    1604 1606   55.84   55.90    7.67    0.54 -124.80 -148.72   12.81
   85        204T 204T N   CA   1606 1607   31.83   39.50                  143.50
   86   6490 206F 207I C   N    1630 1632 -105.41 -120.60   91.86    4.67  -63.40   93.30   14.23
   86        207I 207I N   CA   1632 1633   39.71  130.30                  -43.60
   87   6495 211E 212A C   N    1669 1671   59.63  -68.20  132.53   12.29  -68.20  132.53   12.29
   87        212A 212A N   CA   1671 1672 -179.71  145.30                  145.30
   88   6496 212A 213E C   N    1674 1676  -79.36  -69.30   55.93    4.60  -63.60  128.76   16.35
   88        213E 213E N   CA   1676 1677   87.49  142.50                  -40.30
   89   6499 215G 216R C   N    1698 1700  -71.27  -72.10   26.00    1.98  -63.00  157.23   20.70
   89        216R 216R N   CA   1700 1701  115.91  141.90                  -41.10
   90   6500 216R 217K C   N    1709 1711  -62.28  -70.20    8.10    0.63  -62.90  177.12   22.97
   90        217K 217K N   CA   1711 1712  142.08  140.40                  -40.80
   91   6502 218I 219D C   N    1726 1728 -110.14  -96.50   23.51    0.99  -63.30  179.56   19.80
   91        219D 219D N   CA   1728 1729  133.35  114.20                  -40.00
   92   6503 219D 220M C   N    1734 1736  -87.69  -73.00   24.17    1.51  -63.40  159.16   25.70
   92        220M 220M N   CA   1736 1737  162.20  143.00                  -40.50
   93   6504 220M 221A C   N    1742 1744  -71.59  -68.20   12.76    0.91  -62.50  161.76   26.96
   93        221A 221A N   CA   1744 1745  157.60  145.30                  -40.90
   94   6505 221A 222S C   N    1747 1749  -66.81  -72.40   20.68    1.04  -64.10  167.51   11.98
   94        222S 222S N   CA   1749 1750  132.48  152.40                  -35.00
   95   6506 222S 223G C   N    1753 1755 -177.34 -167.20   43.37    1.78   82.20  159.53   11.94
   95        223G 223G N   CA   1755 1756  132.43  174.60                    8.50
   96   6507 223G 224E C   N    1757 1759 -130.08 -117.80   12.40    0.50  -63.60 -172.46   22.11
   96        224E 224E N   CA   1759 1760  135.07  136.80                  -40.30


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0   14   22  114  127  202  219  224  227  217  255


<< end of ENERGY.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.
iupac_m_397W> Atoms were not swapped because of the uncertainty of how to handle the H atom.


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1800    1800
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    13098   13098
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     3867
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :        1631.2037





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1839       0      0   0.005   0.005      11.534       1.000
 2 Bond angle potential               :    2488       0      6   2.039   2.039      192.80       1.000
 3 Stereochemical cosine torsion poten:    1178       0     53  47.981  47.981      430.81       1.000
 4 Stereochemical improper torsion pot:     779       0      0   1.161   1.161      21.169       1.000
 5 Soft-sphere overlap restraints     :    3867       0      0   0.004   0.004      7.8121       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2356       0      8   0.720   0.720      183.44       1.000
10 Distance restraints 2 (N-O)        :    2508       2      6   0.773   0.773      225.48       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     227       0      3   4.712   4.712      59.425       1.000
14 Sidechain Chi_1 dihedral restraints:     187       0      2  82.287  82.287      66.325       1.000
15 Sidechain Chi_2 dihedral restraints:     146       0      2  76.831  76.831      64.984       1.000
16 Sidechain Chi_3 dihedral restraints:      63       0      0  77.150  77.150      44.382       1.000
17 Sidechain Chi_4 dihedral restraints:      24       0      0  79.210  79.210      13.081       1.000
18 Disulfide distance restraints      :       0       0      0   0.000   0.000      0.0000       1.000
19 Disulfide angle restraints         :       0       0      0   0.000   0.000      0.0000       1.000
20 Disulfide dihedral angle restraints:       0       0      0   0.000   0.000      0.0000       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :     900       0      0   0.621   0.621      14.354       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     225      97     43  39.157 110.887      281.65       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     177       0      0   1.625   1.625      13.801       1.000
27 Distance restraints 5 (X-Y)        :       1       0      0   0.072   0.072     0.15270       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: P62693.V99990002
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   34468.6250



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1  10754  86L  52D N   O     672  413    5.76    2.95    2.80    6.19    2.95    2.80    6.19
    2  10777  86L 194K N   O     672 1531   14.46   10.49    3.97    5.33   10.49    3.97    5.33

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   6302  18R  19L C   N     141  143   61.11   60.20    4.76    0.21  -63.50  141.07   26.02
    1         19L  19L N   CA    143  144   24.93   29.60                  -41.20
    2   6304  20T  21A C   N     156  158   56.60   55.40    6.06    0.27  -62.50  139.77   28.41
    2         21A  21A N   CA    158  159   32.26   38.20                  -40.90
    3   6305  21A  22Y C   N     161  163   70.12   55.90   25.62    1.27 -124.30 -157.13   16.78
    3         22Y  22Y N   CA    163  164   18.19   39.50                  135.40
    4   6316  32T  33I C   N     262  264  -59.31  -63.40   10.07    1.80 -120.60  175.74    7.86
    4         33I  33I N   CA    264  265  -34.40  -43.60                  130.30
    5   6317  33I  34G C   N     270  272   96.16   82.20   14.81    1.13  -62.40  167.71   31.53
    5         34G  34G N   CA    272  273   13.45    8.50                  -41.20
    6   6320  36G  37H C   N     292  294 -158.96 -125.60  109.51    4.70  -63.20  122.75   14.46
    6         37H  37H N   CA    294  295   34.49  138.80                  -42.30
    7   6321  37H  38Y C   N     302  304   58.70   55.90    8.32    0.41 -124.30 -154.85   17.04
    7         38Y  38Y N   CA    304  305   31.67   39.50                  135.40
    8   6333  49A  50Q C   N     390  392   82.70   55.10   42.24    2.42 -121.10 -155.90   10.28
    8         50Q  50Q N   CA    392  393    8.33   40.30                  139.70
    9   6338  54Q  55L C   N     427  429   90.31   60.20  150.83   11.59 -108.50  167.32    7.53
    9         55L  55L N   CA    429  430  177.39   29.60                  132.50
   10   6344  60N  61N C   N     476  478 -141.69 -119.90   22.40    0.80  -63.20 -166.60   28.62
   10         61N  61N N   CA    478  479  142.14  137.00                  -41.10
   11   6345  61N  62K C   N     484  486 -156.18 -118.00   44.34    1.47  -62.90 -176.91   29.33
   11         62K  62K N   CA    486  487  161.65  139.10                  -40.80
   12   6346  62K  63Y C   N     493  495 -144.26 -124.30   69.18    2.92  -63.50  140.50   26.03
   12         63Y  63Y N   CA    495  496 -158.37  135.40                  -43.40
   13   6347  63Y  64A C   N     505  507  -54.44  -68.20   17.76    1.14  -62.50  175.17   29.11
   13         64A  64A N   CA    507  508  134.09  145.30                  -40.90
   14   6351  67V  68D C   N     532  534 -120.11  -96.50   25.15    1.04  -63.30  172.46   18.64
   14         68D  68D N   CA    534  535  122.84  114.20                  -40.00
   15   6352  68D  69A C   N     540  542  -61.76  -68.20   12.89    0.83  -62.50  175.03   28.72
   15         69A  69A N   CA    542  543  134.13  145.30                  -40.90
   16   6353  69A  70Y C   N     545  547   61.90  -98.40  160.40    6.29  -63.50 -151.92   38.73
   16         70Y  70Y N   CA    547  548  122.65  128.40                  -43.40
   17   6355  71V  72K C   N     564  566 -151.34 -118.00   38.54    1.28  -62.90 -176.51   29.11
   17         72K  72K N   CA    566  567  158.43  139.10                  -40.80
   18   6356  72K  73G C   N     573  575   62.75   78.70   16.14    0.75   82.20  173.25    9.38
   18         73G  73G N   CA    575  576 -163.65 -166.10                    8.50
   19   6357  73G  74K C   N     577  579 -116.93 -118.00   51.72    2.52  -62.90  139.30   21.32
   19         74K  74K N   CA    579  580 -169.19  139.10                  -40.80
   20   6360  76N  77Q C   N     599  601   62.81  -73.00  142.65   10.87  -63.80 -174.67   24.04
   20         77Q  77Q N   CA    601  602 -175.64  140.70                  -40.30
   21   6361  77Q  78N C   N     608  610  -82.18  -71.20   15.50    0.83  -63.20  166.25   21.85
   21         78N  78N N   CA    610  611  153.74  142.80                  -41.10
   22   6362  78N  79E C   N     616  618  -68.66  -69.30   25.66    1.94  -63.60  157.23   20.69
   22         79E  79E N   CA    618  619  116.85  142.50                  -40.30
   23   6363  79E  80F C   N     625  627 -170.48 -124.20   70.01    1.95  -63.20  160.86   28.57
   23         80F  80F N   CA    627  628 -164.16  143.30                  -44.30
   24   6364  80F  81D C   N     636  638  -61.56  -70.90   18.18    0.61  -63.30  174.71   21.67
   24         81D  81D N   CA    638  639  134.70  150.30                  -40.00
   25   6365  81D  82A C   N     644  646  -76.31  -68.20   18.96    1.26  -62.50  157.27   26.47
   25         82A  82A N   CA    646  647  162.44  145.30                  -40.90
   26   6366  82A  83L C   N     649  651  -97.21  -70.70   81.25    5.27  -63.50  105.90   16.79
   26         83L  83L N   CA    651  652 -141.59  141.60                  -41.20
   27   6368  84V  85S C   N     664  666 -130.62 -136.60   42.49    2.27  -64.10  147.58   15.46
   27         85S  85S N   CA    666  667 -166.74  151.20                  -35.00
   28   6371  87A  88Y C   N     683  685   62.25  -63.50  136.62   25.52  -63.50  136.62   25.52
   28         88Y  88Y N   CA    685  686   10.02  -43.40                  -43.40
   29   6375  91G  92N C   N     713  715 -161.36 -119.90   47.03    1.44  -63.20 -172.54   28.88
   29         92N  92N N   CA    715  716  159.19  137.00                  -41.10
   30   6379  95V  96A C   N     746  748  -62.52  -68.20   23.36    2.08  -62.50  151.14   24.77
   30         96A  96A N   CA    748  749  167.96  145.30                  -40.90
   31   6381  97D  98G C   N     759  761  130.52   78.70   54.82    2.22   82.20  174.32   10.78
   31         98G  98G N   CA    761  762  175.99 -166.10                    8.50
   32   6382  98G  99W C   N     763  765  -78.67 -124.90   50.09    1.74  -63.00  169.05   20.25
   32         99W  99W N   CA    765  766  124.13  143.40                  -44.20
   33   6384 100A 101P C   N     782  784  -50.33  -58.70   41.27    2.79  -64.50  142.60   11.40
   33        101P 101P N   CA    784  785  -70.91  -30.50                  147.20
   34   6385 101P 102F C   N     789  791 -139.00 -124.20   70.12    3.62   58.10  168.19   25.30
   34        102F 102F N   CA    791  792   74.77  143.30                   32.90
   35   6387 103S 104H C   N     806  808 -139.06 -125.60   42.06    1.81  -63.20  160.34   17.05
   35        104H 104H N   CA    808  809   98.95  138.80                  -42.30
   36   6388 104H 105A C   N     816  818 -125.57 -134.00    9.03    0.21  -62.50 -173.65   33.91
   36        105A 105A N   CA    818  819  143.75  147.00                  -40.90
   37   6389 105A 106Y C   N     821  823 -109.80  -98.40   60.94    6.33  -63.50  121.13   17.18
   37        106Y 106Y N   CA    823  824   68.53  128.40                  -43.40
   38   6391 107C 108A C   N     839  841  -53.17  -68.20   15.04    1.29   55.40  152.79    8.11
   38        108A 108A N   CA    841  842  145.71  145.30                   38.20
   39   6392 108A 109S C   N     844  846  -66.99  -72.40   10.83    0.50  -64.10  178.05   12.73
   39        109S 109S N   CA    846  847  143.03  152.40                  -35.00
   40   6395 111I 112P C   N     866  868  -77.62  -58.70   27.04    1.88  -64.50  158.92   12.56
   40        112P 112P N   CA    868  869  -11.18  -30.50                  147.20
   41   6396 112P 113K C   N     873  875  -67.24  -70.20   15.99    1.23  -62.90  163.15   21.43
   41        113K 113K N   CA    875  876  156.11  140.40                  -40.80
   42   6397 113K 114Y C   N     882  884 -128.10 -124.30   20.23    0.92  -63.50  173.78   30.80
   42        114Y 114Y N   CA    884  885  155.27  135.40                  -43.40
   43   6398 114Y 115R C   N     894  896  -73.69  -72.10   37.15    2.89  -63.00  146.27   19.06
   43        115R 115R N   CA    896  897  104.78  141.90                  -41.10
   44   6399 115R 116N C   N     905  907 -155.43 -119.90   45.29    1.31  -63.20  179.34   27.54
   44        116N 116N N   CA    907  908  165.09  137.00                  -41.10
   45   6400 116N 117A C   N     913  915  -70.02  -68.20   10.71    0.80  -62.50  163.42   27.16
   45        117A 117A N   CA    915  916  155.85  145.30                  -40.90
   46   6401 117A 118G C   N     918  920   63.71   78.70   61.82    1.17   82.20  116.11    6.55
   46        118G 118G N   CA    920  921 -106.13 -166.10                    8.50
   47   6403 119G 120Q C   N     926  928  -74.01  -73.00   14.41    0.96  -63.80  166.94   24.02
   47        120Q 120Q N   CA    928  929  126.32  140.70                  -40.30
   48   6405 121V 122L C   N     942  944  -74.61  -70.70    4.08    0.33  -63.50  176.38   25.14
   48        122L 122L N   CA    944  945  142.77  141.60                  -41.20
   49   6407 123Q 124G C   N     959  961   70.51   78.70   15.37    0.75   82.20  172.79    7.80
   49        124G 124G N   CA    961  962 -179.10 -166.10                    8.50
   50   6408 124G 125L C   N     963  965 -139.84 -108.50   48.41    2.21  -63.50  167.77   28.01
   50        125L 125L N   CA    965  966  169.40  132.50                  -41.20
   51   6420 136F 137N C   N    1069 1071 -148.68  -63.20   95.58   12.10  -63.20   95.58   12.10
   51        137N 137N N   CA   1071 1072    1.67  -41.10                  -41.10
   52   6421 137N 138K C   N    1077 1079 -120.01 -118.00   11.98    0.55  -62.90  177.71   26.48
   52        138K 138K N   CA   1079 1080  150.91  139.10                  -40.80
   53   6422 138K 139P C   N    1086 1088  -46.79  -58.70   30.78    1.82  -64.50  154.94   12.52
   53        139P 139P N   CA   1088 1089  -58.88  -30.50                  147.20
   54   6424 140V 141S C   N    1100 1102 -104.43 -136.60   47.25    1.55  -64.10  156.86    9.74
   54        141S 141S N   CA   1102 1103  116.58  151.20                  -35.00
   55   6425 141S 142S C   N    1106 1108 -154.12 -136.60   23.52    0.74  -64.10 -178.06   19.66
   55        142S 142S N   CA   1108 1109  166.89  151.20                  -35.00
   56   6426 142S 143N C   N    1112 1114  -78.52  -71.20   22.74    1.66  -63.20  163.09   19.58
   56        143N 143N N   CA   1114 1115  121.27  142.80                  -41.10
   57   6427 143N 144S C   N    1120 1122  -93.75  -72.40   31.73    1.48  -64.10  152.05   13.01
   57        144S 144S N   CA   1122 1123  175.87  152.40                  -35.00
   58   6428 144S 145N C   N    1126 1128 -136.45 -119.90   36.39    1.24  -63.20  166.47   24.94
   58        145N 145N N   CA   1128 1129  169.41  137.00                  -41.10
   59   6429 145N 146Q C   N    1134 1136  -76.49  -73.00   13.92    0.98  -63.80  168.01   24.05
   59        146Q 146Q N   CA   1136 1137  127.23  140.70                  -40.30
   60   6430 146Q 147N C   N    1143 1145 -158.71  -63.20  116.35   19.11  -63.20  116.35   19.11
   60        147N 147N N   CA   1145 1146 -107.54  -41.10                  -41.10
   61   6432 148N 149Q C   N    1159 1161  -54.32  -73.00   18.72    1.36  -63.80  178.04   25.69
   61        149Q 149Q N   CA   1161 1162  141.91  140.70                  -40.30
   62   6433 149Q 150T C   N    1168 1170 -138.37 -124.80   29.46    0.93  -63.20  166.22   26.19
   62        150T 150T N   CA   1170 1171  169.65  143.50                  -42.10
   63   6434 150T 151G C   N    1175 1177   73.15   78.70   41.72    0.96   82.20  133.56    6.94
   63        151G 151G N   CA   1177 1178 -124.75 -166.10                    8.50
   64   6435 151G 152G C   N    1179 1181  -66.12  -80.20   26.46    0.64   82.20 -153.84    6.58
   64        152G 152G N   CA   1181 1182  151.69  174.10                    8.50
   65   6438 154I 155K C   N    1199 1201 -162.47 -118.00   71.62    2.65  -62.90  158.98   26.46
   65        155K 155K N   CA   1201 1202 -164.75  139.10                  -40.80
   66   6439 155K 156M C   N    1208 1210  -88.41  -63.40   92.02   12.04  -63.40   92.02   12.04
   66        156M 156M N   CA   1210 1211   48.05  -40.50                  -40.50
   67   6440 156M 157Y C   N    1216 1218 -119.11 -124.30    5.79    0.33  -63.50 -175.19   26.73
   67        157Y 157Y N   CA   1218 1219  132.84  135.40                  -43.40
   68   6441 157Y 158L C   N    1228 1230  -65.87  -70.70    6.56    0.66  -63.50  172.76   24.12
   68        158L 158L N   CA   1230 1231  146.05  141.60                  -41.20
   69   6443 159I 160I C   N    1244 1246  -60.84  -63.40    5.87    0.90 -120.60 -171.11    8.63
   69        160I 160I N   CA   1246 1247  -48.89  -43.60                  130.30
   70   6444 160I 161G C   N    1252 1254  -75.13  -80.20   55.05    1.92   82.20 -167.58    7.41
   70        161G 161G N   CA   1254 1255  119.29  174.10                    8.50
   71   6445 161G 162L C   N    1256 1258  -69.70  -70.70   21.33    1.65  -63.50  156.01   22.02
   71        162L 162L N   CA   1258 1259  162.91  141.60                  -41.20
   72   6446 162L 163D C   N    1264 1266  -34.47  -70.90   44.79    2.14  -63.30  166.75   22.41
   72        163D 163D N   CA   1266 1267  124.24  150.30                  -40.00
   73   6447 163D 164N C   N    1272 1274 -116.66 -119.90    3.29    0.12  -63.20 -174.61   20.70
   73        164N 164N N   CA   1274 1275  136.42  137.00                  -41.10
   74   6449 165S 166G C   N    1286 1288   62.75   78.70   25.11    0.48   82.20  156.42    8.56
   74        166G 166G N   CA   1288 1289 -146.71 -166.10                    8.50
   75   6450 166G 167K C   N    1290 1292 -116.53 -118.00    2.17    0.11  -62.90 -173.62   27.39
   75        167K 167K N   CA   1292 1293  140.70  139.10                  -40.80
   76   6451 167K 168A C   N    1299 1301 -158.84 -134.00   53.12    2.21  -62.50  157.94   30.93
   76        168A 168A N   CA   1301 1302 -166.05  147.00                  -40.90
   77   6452 168A 169K C   N    1304 1306  -53.29  -70.20   17.46    1.17  -62.90  177.10   23.54
   77        169K 169K N   CA   1306 1307  136.04  140.40                  -40.80
   78   6454 170H 171W C   N    1323 1325  -70.96  -71.30    0.90    0.08  -63.00  176.15   22.51
   78        171W 171W N   CA   1325 1326  139.83  139.00                  -44.20
   79   6455 171W 172Y C   N    1337 1339 -105.76  -98.40   15.84    1.55  -63.50  179.23   30.60
   79        172Y 172Y N   CA   1339 1340  142.43  128.40                  -43.40
   80   6456 172Y 173V C   N    1349 1351  -59.44  -62.40    8.01    0.89 -125.40  179.43   10.12
   80        173V 173V N   CA   1351 1352  -49.84  -42.40                  143.30
   81   6457 173V 174S C   N    1356 1358 -168.66 -136.60  100.14    4.30  -64.10  131.01   16.83
   81        174S 174S N   CA   1358 1359 -113.93  151.20                  -35.00
   82   6458 174S 175D C   N    1362 1364  -40.94  -70.90   72.69    5.05  -63.30  105.87   11.89
   82        175D 175D N   CA   1364 1365 -143.48  150.30                  -40.00
   83   6474 190N 191Y C   N    1492 1494   71.04   55.90  155.99   12.05 -124.30  175.03   10.90
   83        191Y 191Y N   CA   1494 1495 -165.24   39.50                  135.40
   84   6487 203D 204T C   N    1604 1606   50.24   55.90    8.16    0.48 -124.80 -159.34    7.73
   84        204T 204T N   CA   1606 1607   45.38   39.50                  143.50
   85   6495 211E 212A C   N    1669 1671   49.41  -68.20  127.65   12.20  -68.20  127.65   12.20
   85        212A 212A N   CA   1671 1672 -165.09  145.30                  145.30
   86   6496 212A 213E C   N    1674 1676  -71.81  -69.30   49.24    3.85  -63.60  133.88   17.41
   86        213E 213E N   CA   1676 1677   93.33  142.50                  -40.30
   87   6497 213E 214F C   N    1683 1685 -107.24 -124.20   29.63    0.90  -63.20  169.14   20.75
   87        214F 214F N   CA   1685 1686  119.00  143.30                  -44.30
   88   6498 214F 215G C   N    1694 1696  -55.41  -62.40    6.99    1.25   82.20  146.26   11.16
   88        215G 215G N   CA   1696 1697  -41.04  -41.20                    8.50
   89   6499 215G 216R C   N    1698 1700  -70.58  -72.10   15.01    1.12  -63.00  168.23   22.23
   89        216R 216R N   CA   1700 1701  126.96  141.90                  -41.10
   90   6500 216R 217K C   N    1709 1711  -94.04 -118.00   25.65    0.86  -62.90  173.56   21.03
   90        217K 217K N   CA   1711 1712  129.94  139.10                  -40.80
   91   6502 218I 219D C   N    1726 1728  -85.56  -70.90   22.68    0.84  -63.30  154.02   20.42
   91        219D 219D N   CA   1728 1729  167.60  150.30                  -40.00
   92   6503 219D 220M C   N    1734 1736 -106.33 -125.60   19.30    0.79  -63.40 -177.00   30.75
   92        220M 220M N   CA   1736 1737  141.60  140.50                  -40.50
   93   6504 220M 221A C   N    1742 1744  -74.47  -68.20    6.49    0.60  -62.50  175.87   29.42
   93        221A 221A N   CA   1744 1745  143.64  145.30                  -40.90
   94   6505 221A 222S C   N    1747 1749 -149.74 -136.60   22.30    0.79  -64.10  177.77   19.04
   94        222S 222S N   CA   1749 1750  169.21  151.20                  -35.00
   95   6506 222S 223G C   N    1753 1755   87.51   78.70   28.33    0.48   82.20  158.56    7.96
   95        223G 223G N   CA   1755 1756  166.97 -166.10                    8.50
   96   6507 223G 224E C   N    1757 1759 -117.42 -117.80    8.09    0.40  -63.60  177.38   21.19
   96        224E 224E N   CA   1759 1760  128.72  136.80                  -40.30
   97   6509 227A 228A C   N    1788 1790   67.47   55.40   31.53    1.15 -134.00 -149.87   11.99
   97        228A 228A N   CA   1790 1791    9.08   38.20                  147.00


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0   21   29  143  181  217  199  224  250  269  276


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
P62693.B99990001.pdb          1450.60339
P62693.B99990002.pdb          1631.20374

In [ ]:
score_ala = evaluate_model('P62693.B99990001.pdb')
readlinef__W> File: P62693.B99990001.pdb, Line: 6
              Modeller will only read the first 80 characters of this line.

selection__W> The class 'selection' is deprecated; use 'Selection' instead
>> Model assessment by DOPE potential
iatmcls_286W> MODEL atom not classified:  LYS:OXT  LYS
iatmcls_286W> MODEL atom not classified:  ALA:OXT  ALA
preppdf_453W> No fixed restraints selected; there may be some dynamic ones.
preppdf_454W> Restraints file was probably not read; use restraints.append().


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      229
Number of all, selected real atoms                :     1800    1800
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :        0       0
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):   303450
Dynamic pairs routine                             : 1, NATM x NATM double loop
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        1    9999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :   15.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       F       F       F       T
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :      -16115.1543




<< end of ENERGY.
DOPE score               : -16115.154297
In [ ]:
Image('2.png')
Out[ ]:
No description has been provided for this image
In [ ]:
print(f"Native DOPE score: {score_native}")
print(f"ALA-ligand DOPE score: {score_ala}")
Native DOPE score: -15983.8193359375
ALA-ligand DOPE score: -16115.154296875
In [ ]:
# Более низкий score - это хорошо, но это не обязательно должно быть биологически правильно