FBB MSU site Main page About me Terms

Transmembrane proteins

OPM database

As transmembrane protein include alpha-helix structure I chose Bacterial cellulose synthase (PDB ID - 4p02).

Class: Alpha-helical polytopic
Family: Cellulose-conducting channel
Cellulose synthase - OPM page

Characteristics of this protein you can see in table 1 and it's visualisation in figure 1.

Table 1. Characteristics of cellulose synthase, ID - 4p02.

Hydrophobic Thickness29.8 ± 1.2 Å
2 transmembrane subunits A - Segments: 1( 15- 34), 2( 41- 60), 3( 64- 86), 4( 96- 120), 5( 418- 435), 6( 447- 466), 7( 522- 543), 8( 549- 570)
B - Segments: 1(695-716)
Average number of amino acid residues in a transmembrane alpha-helix20
LocalizationBacterial Gram-negative inner membrane

Figure 1. Visualisation of cellulose synthase, ID - 4p02.


As transmembrane protein include beta-barrel structure I chose Porin OmpF (PDB ID - 3pox).

Class: Beta-barrel transmembrane
Superfamily: Trimeric porins
Family: General Bacterial Porin (GBP)
Porin OmpF - OPM page

Characteristics of this protein you can see in table 2 and it's visualisation in figure 2.

Table 2. Characteristics of Porin OmpF, ID - 3pox.

Hydrophobic Thickness24.0 ± 0.8 Å
3 transmembrane subunits
(the same subunits)
A - Segments: 1( 11- 23), 2( 37- 48), 3( 57- 64), 4( 79- 89), 5( 96- 101), 6( 136- 142), 7( 150- 159), 8( 173- 182), 9( 186- 192), 10( 213- 221), 11( 226- 232), 12( 256- 263), 13( 270- 276), 14( 294- 302), 15( 309- 315), 16( 331- 338)
B - Segments: 1( 11- 23), 2( 37- 48), 3( 57- 64), 4( 79- 89), 5( 96- 101), 6( 136- 142), 7( 150- 159), 8( 173- 182), 9( 186- 192), 10( 213- 221), 11( 226- 232), 12( 256- 263), 13( 270- 276), 14( 294- 302), 15( 309- 315), 16( 331- 338)
C - Segments: 1( 11- 23), 2( 37- 48), 3( 57- 64), 4( 79- 89), 5( 96- 101), 6( 136- 142), 7( 150- 159), 8( 173- 182), 9( 186- 192), 10( 213- 221), 11( 226- 232), 12( 257- 263), 13( 270- 276), 14( 294- 302), 15( 309- 315), 16( 332- 338)
Average number of amino acid residues in a transmembrane beta-chain8
LocalizationBacterial Gram-negative outer membrane

Figure 2. Visualisation of Porin OmpF, ID - 3pox.

Analise of predicted transmembrane helixes

As transmembrane protein include alpha-helix structure I chose Bacterial cellulose synthase (PDB ID - 4p02). In TMHMM and Phobius research I use A chain of this protein (sequence you can see below).

>4P02:A|PDBID|CHAIN|SEQUENCE
MGTVRAKARSPLRVVPVLLFLLWVALLVPFGLLAAAPVAPSAQGLIALSAVVLVALLKPFADKMVPRFLLLSAASMLVMR
YWFWRLFETLPPPALDASFLFALLLFAVETFSISIFFLNGFLSADPTDRPFPRPLQPEELPTVDILVPSYNEPADMLSVT
LAAAKNMIYPARLRTVVLCDDGGTDQRCMSPDPELAQKAQERRRELQQLCRELGVVYSTRERNEHAKAGNMSAALERLKG
ELVVVFDADHVPSRDFLARTVGYFVEDPDLFLVQTPHFFINPDPIQRNLALGDRCPPENEMFYGKIHRGLDRWGGAFFCG
SAAVLRRRALDEAGGFAGETITEDAETALEIHSRGWKSLYIDRAMIAGLQPETFASFIQQRGRWATGMMQMLLLKNPLFR
RGLGIAQRLCYLNSMSFWFFPLVRMMFLVAPLIYLFFGIEIFVATFEEVLAYMPGYLAVSFLVQNALFARQRWPLVSEVY
EVAQAPYLARAIVTTLLRPRSARFAVTAKDETLSENYISPIYRPLLFTFLLCLSGVLATLVRWVAFPGDRSVLLVVGGWA
VLNVLLVGFALRAVAEKQQRRAAPRVQMEVPAEAQIPAFGNRSLTATVLDASTSGVRLLVRLPGVGDPHPALEAGGLIQF
QPKFPDAPQLERMVRGRIRSARREGGTVMVGVIFEAGQPIAVRETVAYLIFGESAHWRTMREATMRPIGLLHGMARILWM
AAASLPKTARDFMDEPARRRRRHEEPKEKQAHLLAFGTDFSTEPDWAGELLDPTAQVSARPNTVAWGSNHHHHHHKLHHH
HHH

Below you can see summary table (see table 3).


The result of TMHMM research you can see in figure 3.
Ox - protein sequence
Oy - probability of amino acid residue is located inside the membrane, in the external environment or in the cytoplasm

Red line - transmembrane part of protein
Blue line - cytoplasmic (inside) part of protein
Pink line - non cytoplasmic (outside) part of protein

Figure 3. Prediction of transmembrane structure of Cellulose synthase A chain made by TMHMM service.

# 4P02:A|PDBID|CHAIN|SEQUENCE Length: 803 
# 4P02:A|PDBID|CHAIN|SEQUENCE Number of predicted TMHs: 8 
# 4P02:A|PDBID|CHAIN|SEQUENCE Exp number of AAs in TMHs: 181.11815 
# 4P02:A|PDBID|CHAIN|SEQUENCE Exp number, first 60 AAs: 42.73374 
# 4P02:A|PDBID|CHAIN|SEQUENCE Total prob of N-in: 0.99963 
# 4P02:A|PDBID|CHAIN|SEQUENCE POSSIBLE N-term signal sequence 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 inside 1 11 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 12 34 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 outside 35 37 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 38 60 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 inside 61 66 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 67 84 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 outside 85 98 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 99 121 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 inside 122 416 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 417 439 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 outside 440 448 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 449 468 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 inside 469 523 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 524 546 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 outside 547 550 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 TMhelix 551 573 
4P02:A|PDBID|CHAIN|SEQUENCE TMHMM2.0 inside 574 803 

The result of Phobius research you can see in figure 4.
Ox - protein sequence
Oy - probability of amino acid residue is located inside the membrane, in the external environment or in the cytoplasm

Grey line - transmembrane part of protein
Green line - cytoplasmic (inside) part of protein
Blue line - non cytoplasmic (outside) part of protein
Red line - signal peptide

Figure 4. Prediction of transmembrane structure of Cellulose synthase A chain made by Phobius service.

ID   4P02:A|PDBID|CHAIN|SEQUENCE
FT   TOPO_DOM      1     11       CYTOPLASMIC.
FT   TRANSMEM     12     36       
FT   TOPO_DOM     37     41       NON CYTOPLASMIC.
FT   TRANSMEM     42     61       
FT   TOPO_DOM     62     67       CYTOPLASMIC.
FT   TRANSMEM     68     87       
FT   TOPO_DOM     88     98       NON CYTOPLASMIC.
FT   TRANSMEM     99    122       
FT   TOPO_DOM    123    416       CYTOPLASMIC.
FT   TRANSMEM    417    437       
FT   TOPO_DOM    438    448       NON CYTOPLASMIC.
FT   TRANSMEM    449    468       
FT   TOPO_DOM    469    524       CYTOPLASMIC.
FT   TRANSMEM    525    545       
FT   TOPO_DOM    546    550       NON CYTOPLASMIC.
FT   TRANSMEM    551    571       
FT   TOPO_DOM    572    803       CYTOPLASMIC.

Table 3. Transmembrane alpha-helixes predicted by TMHMM and Phobius and ones presented in OPM database.

OPM1( 15- 34), 2( 41- 60), 3( 64- 86), 4( 96- 120), 5( 418- 435), 6( 447- 466), 7( 522- 543), 8( 549- 570)
TMHMM1(12 - 34), 2(38 - 60), 3(67 - 84), 4(99 - 121), 5(417 - 439), 6(449 - 468), 7(524 - 546), 8(551 - 573)
Phobius1(12 - 36), 2(42 - 61), 3(68 - 87), 4(99 - 122), 5(417 - 437), 6(449 - 468), 7(525 - 545), 8(551 - 571)

Summary:
The number of predicted helixes is the same as presented in OPM. Coordinates of the predicted helixes are very close to the real ones (may vary by 1-3 residues). So I think in this case predicted transmembrane structure are reliable.

TCDB database

TCID:

  • Position 1 - class of transporter protein
  • Position 2 - subclass
  • Position 3 - family
  • Position 4 - subfamily
  • Position 5 - the protein

Chosen proteins were found in TCDB.

  1. Cellulose synthase, ID - 4p02
    TCID - 4.D.3.1.5

    • 4 - Group translocators (Белки - транспортеры)
    • D - Polysaccharide Synthase/Exporters (Белки, синтезирующие и секретирующие полисахариды)
    • 3 - The Glycan Glucosyl Transferase (OpgH) Family (Семейство гликан глюкозил трансфераз)
    • 1.5 - Putative cellulose synthase (Целлюлозо-синтаза)
    • Substrate - Cellulose


    Cellulose synthase and transporter, BcsA, which functions with BcsB (periplasmic protein with an N-terminal TMS) and BcsC (an 18 beta-stranded outer membrane porin). The x-ray structure of the BcsA-B complex has been determined at 3.5 Å resolution (Morgan et al. 2013). Cellulose is synthesized and secreted by the membrane-integrated cellulose synthase. Substrate- and product-bound structures of BcsA provided the basis for substrate recognition and demonstrated the stepwise elongation of cellulose. Structural snapshots showed that BcsA translocates cellulose via a ratcheting mechanism involving a 'finger helix' that contacts the polymer's terminal glucose. Cooperating with BcsA's gating loop, the finger helix moves 'up' and 'down' in response to substrate binding and polymer elongation, respectively, thereby pushing the elongated polymer into BcsA's transmembrane channel. This mechanism was validated by tethering BcsA's finger helix, which inhibits polymer translocation but not elongation (Morgan et al. 2016). [*]

    PDB structures: 4HG6, 4P00, 4P02
  2. Porin OmpF, ID - 3pox
    TCID - 1.B.1.1.1

    • 1 - Channels and pores (Каналы и поры)
    • B - beta-Barrel porins and other outer membrane proteins (Порины в виде бета-боченков и другие мембранные белки)
    • 1 - General bacterial porin family (Семейство, объединяющее порины бактерий)
    • 1.1 - OMPF aka TOLF aka CMLB aka COA aka CRY aka B0929
    • Substrate - Ceftriaxone, Cefpirome, ions, peptides, Colicin E9, Protamine, Ceftazidime


    OmpF general porin. OmpF can deliver peptides of >6 KDa (epitopes) including protamine, through the pore lumen from the periplasm to the outside (Housden et al., 2010; Ghale et al. 2014). For cephalosporin antibiotics, the interaction strength series is ceftriaxone > cefpirome > ceftazidime (Lovelle et al. 2011). An unfolded protein such as colicin E9 can thread through OmpF from the outside to reach the periplasm (Housden et al. 2013). Polynucleotides can pass through OmpF (Hadi-Alijanvand and Rouhani 2015). LPS influences the movement of bulk ions (K+ and Cl-), but the ion selectivity of OmpF is mainly affected by bulk ion concentrations (Patel et al. 2016). OMPs such as OmpF cluster into islands that restrict their lateral mobility, while IMPs generally diffuse throughout the cell. Rassam et al. 2018 demonstrated that when transient, energy-dependent transmembrane connections are formed, IMPs become subjugated by the inherent organisation of OMPs, and that such connections impact IMP function. They showed that while establishing a translocon for import, colicin ColE9 sequesters the IMPs of the proton motive force (PMF)-linked Tol-Pal complex into islands mirroring those of colicin-bound OMPs. Through this imposed organisation, the bacteriocin subverts the outer-membrane stabilizing role of Tol-Pal, blocking its recruitment to cell division sites and slowing membrane constriction. The ordering of IMPs by OMPs via an energised inter-membrane bridge represents an emerging functional paradigm in cell envelope biology (Rassam et al. 2018). [**]

    PDB structures: more then 10 (too much for my work)

Translation into Russian:

[*] Целлюлозо-синтаза и транспортер, BcsA, функционирующий вместе с BcsB (периплазматический белок с N-концевой TMS) и BcsC (порин из 18 бета-листов, встроенный в наружную мембрану). Рентгеновская структура комплекса BcsA-B определена с разрешением 3,5 Å (Morgan et al. 2013). Целлюлоза синтезируется и секретируется на поверхность встроенным в мембрану комплексом целлюлозо-синтазы. Субстрат- и продукт-связанные структуры BcsA позволили опознать субстрат и пронаблюдать ступенчатый синтез целлюлозы. Структурные снимки показали, что BcsA перемещает целлюлозу с помощью храпового механизма, используя 'finger helix' (структура ‘палец’ из альфа-спиралей), который взаимодействует с терминальной глюкозой в полимере. В комплексе с петлей BcsA 'finger helix' двигает полимер "вверх" и "вниз" в ответ на его связывание и удлинение, соответственно, таким образом протягивая целлюлозу через трансмембранный канал BcsA. Этот механизм подтверждается тем, что, если блокировать 'finger helix' BcsA, транслокация полимера прекращается, но он продолжает удлиняться (Morgan et al. 2016).

[**] OmpF типичный белок порин. OmpF может доставлять пептиды >6 KDa (эпитопы), в том числе протамин, через просвет поры из периплазматического пространства наружу (Housden et al., 2010; Ghale et al. 2014). Для цефалоспориновых антибиотиков прочность связывания падает в ряду ceftriaxone > cefpirome > ceftazidime (Lovelle et al. 2011). Белки в нативной конформации, например колицин E9, могут проникать в клетку извне через порины (Housden et al. 2013). Полинуклеотиды также могут проходить через OmpF (Hadi-Alijanvand и Rouhani 2015). Липополисахариды (LPS) влияют на движение объемных ионов (K+ и Cl -), но селективность прохода ионов через OmpF в основном зависит от их концентрации (Patel et al. 2016). Комплексы OMP, такие как OmpF, объединяются в островки, с ограниченной боковой подвижностью, в то время как комплексы вроде IMP обычно распределены по всей клетке. Рассам с коллегами в 2018 продемонстрировал, что при формировании переходных, энергозависимых трансмембранных соединений, IMP подчиняются внутренней организации со стороны OMP, более того OMP влияют на функцию IMP. Было показано, что при создании транслокона для импорта колицин ColE9 изолирует IMP от связанного с протонной движущей силой (PMF) комплекса Tol-Pal, путем образования OMP-колицин связанных комплексов в OMP-островках. В результате бактериоцин берет на себя роль наружной мембраны, стабилизируя Tol-Pal, блокируя его захват в сайтах деления клетки и замедляя сужение мембраны. Упорядочение IMP с помощью OMP путем активации внутренне-мембранного моста представляет собой формирующуюся функциональную парадигму в биологии клеточной оболочки (Rassam et al. 2018).

Term 4

← Pr11Term 5 →


© Darya Potanina, 2018